Recombinant Mouse Lysocardiolipin acyltransferase 1 (Lclat1)

Code CSB-CF012807MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Lclat1
Uniprot No.
Alternative Names
Lclat1; Agpat8; Alcat1; Gm91; Lycat; Lysocardiolipin acyltransferase 1; 1-acylglycerol-3-phosphate O-acyltransferase 8; 1-AGP acyltransferase 8; 1-AGPAT 8; Acyl-CoA:lysocardiolipin acyltransferase 1
Species
Mus musculus (Mouse)
Expression Region
1-376
Target Protein Sequence
MVSWKGIYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSRLVATWLTLPVALLET MFGVRVVITGDAFVPGERSVIIMNHRTRVDWMFLWNCLMRYSYLRVEKICLKSSLKSVPG FGWAMQVAAFIFIHRKWKDDKSHFEDMIDYFCAIHEPLQLLIFPEGTDLTENNKARSNDF AEKNGLQKYEYVLHPRTTGFTFVVDRLREGKNLDAVHDITVAYPYNIPQTEKHLLLGDFP KEIHFHVQRYPADSLPTSKEDLQLWCHRRWEEKEERLRSFYQGEKNFHFTGQSTVPPCKS ELRVLVVKLLSIVYWALFCSAMCLLIYLYSPVRWYFIISIVFFVLQERIFGGLEIIELAC YRFLHKHPHLNSKKNE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Exhibits acyl-CoA:lysocardiolipin acyltransferase (ALCAT) activity; catalyzes the reacylation of lyso-cardiolipin to cardiolipin (CL), a key step in CL remodeling. Recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. Also exhibits 1-acyl-sn-glycerol-3-phosphate acyltransferase activity (AGPAT) activity; converts 1-acyl-sn-glycerol-3- phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3- phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Possesses lysophosphatidylinositol acyltransferase (LPIAT) activity. Possesses lysophosphatidylglycerol acyltransferase (LPGAT) activity. Required for establishment of the hematopoietic and endothelial lineages.
Gene References into Functions
  1. Lycat regulates TGF-beta mediated lung fibroblast differentiation in pulmonary fibrosis. PMID: 28751023
  2. Alcat1 is destabilized in epithelia by lipopolysaccharide (LPS) impairing mitochondrial function. PMID: 26604221
  3. Differential reduction in cardiac and liver monolysocardiolipin acyltransferase-1 and reduction in cardiac and liver tetralinoleoyl-cardiolipin in the alpha-subunit of trifunctional protein heterozygous knockout mice PMID: 26251360
  4. pathological cardiolipin remodeling by ALCAT1 linked to the pathogenesis of nonalcoholic fatty liver diseases PMID: 25203315
  5. LYCAT expression was altered in peripheral blood mononuclear cells and outcome in pulmonary fibrosis. PMID: 24779708
  6. findings implicate a key role of ALCAT1 as the missing link between oxidative stress and mitochondrial dysfunction in the etiology of age-related heart diseases PMID: 22949503
  7. Data indicate that LYCAT is a determinant of PI molecular species and its function is conserved in C. elegans and mammals. PMID: 22172515
  8. ALCAT1 deficiency prevented the onset of DIO and significantly improved mitochondrial complex I activity, lipid oxidation, and insulin signaling. PMID: 20674860
  9. Expression of Lclat1 gene in the mouse cardiovascular system is reported. PMID: 20503378
  10. Includes the study of an upstream ORF in this gene, and shows that it functions to reduce protein levels by ~40%. PMID: 19372376
  11. identification and characterization of a gene that encodes an acyl-CoA:lysocardiolipin acyltransferase 1 PMID: 15152008
  12. Mouse Lycat plays an important role in the early specification of hematopoietic and endothelial cells. PMID: 17675553
  13. A regulatory role of ALCAT1 in cardiolipin remodeling in response to oxidative stress, ALCAT1 expression in liver and heart was significantly downregulated in mice with hypothyroidism and upregulated in mice treated with thyroid hormone. PMID: 19106248

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Tissue Specificity
Widely expressed with highest expression in heart, liver and E12.5 aorta-gonad-mesonephros and lower levels in the E16 fetal liver and adult bone marrow. In bone marrow, highest levels are found in B-cells compared with whole bone marrow, T-cells, erythro
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X