Recombinant Mouse Membrane progestin receptor beta(Paqr8)

Code CSB-CF772178MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q80ZE5
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MTTAILERLSTLSMSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGH EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTLPLLLFILSSI TYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYELFWIFFL PAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFVLDISPVAHRVALCHLAGC QEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAI LLDYQGRHEIFLQRHGPLSVYSACLSFFVLAACSAATATLLRHKVKDRLIKKDS
Source in vitro E.coli expression system
Gene Names Paqr8
Protein Names Recommended name: Membrane progestin receptor beta Short name= mPR beta Alternative name(s): Progestin and adipoQ receptor family member VIII
Expression Region 1-354
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway (By similarity). May be involved in oocyte maturation
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Tissue Specificity Expressed in brain and testis.
Database Links

KEGG: mmu:74229

STRING: 10090.ENSMUSP00000069127

UniGene: Mm.40780

Related Products

Paqr8 Proteins

Paqr8 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.