Recombinant Mouse Myelin protein P0 (Mpz)

Code CSB-CF014774MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Mpz
Uniprot No.
Alternative Names
Mpz; P0; Myelin protein P0; Myelin peripheral protein; MPP; Myelin protein zero
Species
Mus musculus (Mouse)
Expression Region
30-248
Target Protein Sequence
IVVYTDREIYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGAFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGILGVVLLLLLLFYLIRYCWLRRQAALQRRLSAMEKGRFHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGLGESRKDKK
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction.
Gene References into Functions
  1. Data show that both transgenic Wnt1-cre and P0-cre are similarly effective in deleting beta-catenin in the neural crest. PMID: 27184910
  2. In the absence of P0, thus, PLP also contributes to myelination by Schwann cells and to the preservation of peripheral axons PMID: 26393339
  3. interaction with neurofascins impaired by mutations D6Y, D32G, and H52Y responsible for late onset forms of the human disease PMID: 26406915
  4. while PLP can co-exist with P0 in peripheral nervous system(PNS) myelin, PLP cannot replace P0 as the major structural protein of PNS myelin. PMID: 25066805
  5. Mpz-induced murine experimental autoimmune neuritis is a CD4-positive T cell-mediated monophasic axonal inflammatory neuropathy. PMID: 24709684
  6. This study demonistrated that prolonged high frequency electrical stimulation is lethal to motor axons of mice heterozygously deficient for the myelin protein P gene. PMID: 23439028
  7. results provide a potential link between the accumulation of MpzR98C in the endoplasmic reticulum and a developmental delay in myelination. PMID: 22689911
  8. Mutant autoimmune regulator protein-mediated central tolerance to Mpz initiates an autoimmune T helper type (Th)1 cell effector response toward peripheral nerves. PMID: 22490868
  9. L-MPZ, a novel isoform of myelin P0, is produced by stop codon readthrough. PMID: 22457349
  10. Glycoprotein P0 performs distinct actions on the formation, maturation, degeneration and regeneration of sciatic nerve myelin sheath. PMID: 21824506
  11. P0S63del in the ER reduces P0 density in myelin by half, which is known to cause pathology in both mice and humans. PMID: 21363884
  12. Isolation and function of mouse tissue resident vascular precursors marked by myelin protein zero. PMID: 21536740
  13. a rare myelin protein zero (MPZ) variant alters enhancer activity in vitro and in vivo PMID: 21179557
  14. P0 (protein zero) mutation S34C underlies instability of internodal myelin in S63C mice PMID: 20937820
  15. Data show that in myelin protein zero (P0+/-) mutants CCR2 decreases macrophage activation and is protective against demyelination, whereas in P0-/- mice it increases the accumulation of endoneurial macrophages. PMID: 20553884
  16. p0 promoter is activated by IL6 ligand plus its receptor when there is a C/G-rich CACC box in the Po promoter PMID: 12643284
  17. A study using P0-deficient mice with wild-type bone marrow chimeras demonstrates that the T cell response to P0 is tolerized in wild-type mice but not in P0 knockouts, primarily because of P0 expression in thymic stromal cells. PMID: 14734711
  18. The Ile106Leu mutation acts by a dominant-negative gain of function and that the P0sub-transgenic mouse represents an animal model for a severe, tomaculous form of CMT1B. PMID: 15148307
  19. Data show that steroid receptor coactivator-1 (SRC-1) overexpressing cells are more responsive to Po mRNA induction by dihydroprogesterone (DHP) than SRC-1-deficient cells, and that DHP treatment increases not only Po but also SRC-1 mRNA levels. PMID: 15456935
  20. Amino acid residues 106-125 of murine peripheral myelin protein P0 (P0106-125) has been identified as a novel neuritogenic epitope that induces peptide-specific CD4+ T cells in spleen and popliteal lymph nodes in a model of autoimmune neuritis. PMID: 15715086
  21. P0 transcripts were identified by in situ hybridization at different stages of the mouse kidney development, especially in embryonic structures that give rise to the glomerulus and in polocyte cell membrane. PMID: 16162811
  22. Results suggest that cooperative interactions between Egr2 and Sox10 mediate a large increase in myelin protein zero expression to the high levels found in myelinating Schwann cells. PMID: 16373334
  23. Results describe the role of the macrophage-restricted sialic acid-binding Ig-like lectin sialoadhesin (Sn, Siglec-1) in the pathogenesis of inherited demyelination in myelin P0(+/-) mice. PMID: 16458537
  24. This is the first evidence for UPR in association with neuropathy and provides a model to determine whether and how mutant proteins can provoke demyelination from outside of myelin. PMID: 16495463
  25. Our findings demonstrate that M-CSF is crucial for the activation, in situ increase and myelin phagocytosis of both long-term and short-term resident endoneurial macrophages in P0+/- myelin mutants. PMID: 16962581
  26. protein is required for and can induce formation of schmidt-lantermann incisures in myelin internodes. PMID: 18614675
  27. Myelin P zero-reactive T cells are involved in the pathogenesis of spontaneous autoimmune polyneuropathy. PMID: 19050296
  28. Myelin P0 is a major autoantigen in autoimmune peripheral neuropathy. PMID: 19221395
  29. findings demonstrate that high-level cholesterol coordinates P0 export with myelin membrane synthesis, which is required for the correct stoichiometry of myelin components and for myelin compaction PMID: 19439587
  30. Early growth response 2 binding to both the intron-associated and upstream enhancers is required for high level induction of myelin protein zero expression in transgenic assays. PMID: 19487693

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Myelin P0 protein family
Tissue Specificity
Found only in peripheral nervous system Schwann cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1