Recombinant Mouse NADPH oxidase 3 (Nox3)

Code CSB-CF015960MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Nox3
Uniprot No.
Alternative Names
Nox3; NADPH oxidase 3
Species
Mus musculus (Mouse)
Expression Region
1-568
Target Protein Sequence
MPVCWILNESGSFVVALLWLAVNAYLFIDTFFWYTEEEAFFYTRVILGSALAWARASAVC LNFNCMLILLPVSRNFISLVRGTSVCCRGPWRRQLDKNLNFHKLVAYGIAVNSVIHIVAH LFNLERYHLGQAKDAEGLLAALSKLGDAPNESYLNPVRTFDMGTTTELLMTVSGITGLGI SLALVFIMTSSTEFIRRSSYELFWYTHHIFVFFFISLAIHGGGRIIRGQTPESLRLHNVT YCRDHYAEWQAAALCPVPQFSGKEPSAWKWALGPVVLYACERIIRFWRSHQEVVITKVVS HPSAVLELHMKKRDFKMAPGQYIFIQCPSVSPLEWHPFTLTSAPQEDFFSVHIRASGDWT EALLKAFRVEGQAPSELCSMPRLAVDGPFGGSLADVFHYPVSVCIATGIGVTPFASLLKS VWYKCCESQSLPELSKVYFYWICRDAGAFEWFADLLLSLETRMSEQGKAHLLSYHIYLTG WDENQAIHIALHWDESLDVITGLKQKAFYGRPNWNDEFKQIAYNHPSSSIGVFFCGSKAM SKTLQKMCRLYSSVDPRGVHFYYNKENF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
NADPH oxidase which constitutively produces superoxide upon formation of a complex with CYBA/p22phox. Plays a role in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity.
Gene References into Functions
  1. Hsp70 activates Stat3 and suppresses Nox3 via TLR4 PMID: 26905942
  2. Together, these findings reveal that Nox2 is a Zn(2+)-regulated enzyme that mediates ZnD-induced oxidative stress and kidney hypertrophy. Understanding the specific mechanisms by which ZnD contributes to kidney damage may have an important impact on the treatment of chronic kidney disease. PMID: 27806940
  3. Nox3 mutants and heterozygotes demonstrated a greater susceptibility to noise-induced hearing loss. PMID: 25880434
  4. Although Nox3 overexpression revealed no apparent effect, depletion of Nox3 decreased the number of spermatogonial stem cells in both cultured spermatogonia and freshly isolated testis cells. PMID: 25947060
  5. Mutations of Nox3 include retrovirus insertion, missense mutations, splice donor mutation, a splice acceptor mutation and premature translational termination. PMID: 21161235
  6. palmitate-induced ROS generation and that NOX3-derived ROS may drive palmitate-induced hepatic insulin resistance through JNK and p38(MAPK) pathways. PMID: 20647313
  7. an allelic series of mutations at the otoconia-deficient head tilt (het) locus, affecting the gene for NADPH oxidase 3 (Nox3), identifies Nox3 as a protein with a clear enzymatic function indispensable for otoconia morphogenesis PMID: 15014044
  8. NOX3 is a relevant source of ROS generation in the cochlear and vestibular systems and that NOX3-dependent ROS generation might contribute to hearing loss and balance problems in response to ototoxic drugs. PMID: 15326186

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in inner ear by the spiral glanglion neurons, the vestibular system and the sensory epithelial cell layer of the saccule. Weakly expressed in skull and brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X