Recombinant Mouse Neuronal acetylcholine receptor subunit beta-4 (Chrnb4)

Code CSB-CF819188MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Chrnb4
Uniprot No.
Alternative Names
Chrnb4; Acrb4; Neuronal acetylcholine receptor subunit beta-4
Species
Mus musculus (Mouse)
Expression Region
21-495
Target Protein Sequence
RLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWL KQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSI QWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMDDFTPSGEW DIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCG EKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHH RSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSPARVPHSSQLHLTTAEATSTSALGPS SPSNLYGNSMYFVNPVPATPKSAVSSHTAGLPRDARLRSSGRFRQDLQEALEGVSFIAQH LESDDRDQSVIEDWKFVAMVVDRLFLWVFVIVCILGTMGLFLPPLFQIHAPSKGL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Gene References into Functions
  1. These findings suggest that beta4* nAChRs in the interpeduncular nucleus have a role in maintaining nicotine intravenous self-administration. PMID: 26585290
  2. Data suggest that the nicotinic acetylcholine receptor beta4 subunit (beta4 subunit) is not involved in ethanol responses. PMID: 28381286
  3. MAFA controls autonomic nervous system-mediated insulin secretion by activating the transcription of nicotinic (ChrnB2 and ChrnB4) receptor genes, which is impaired in type 2 diabetes. PMID: 26904947
  4. The alpha3beta4* nicotinic ACh receptor subtype mediates physical dependence to morphine PMID: 24750073
  5. nAChRs that contain the beta4 subunit are important for social behaviors. PMID: 23042983
  6. Downregulation of nAChR subunit and PSD-93 expression after cavernous nerve injury, or even manipulation, could interrupt synaptic transmission within the MPG and thus contribute to the loss of neural control of urogenital organs after pelvic surgeries. PMID: 24049141
  7. findings suggest an important role for the a3b4* nAChR subtype in nicotine reward and physical aspects of the nicotine withdrawal syndrome. PMID: 23416040
  8. Chrnb4 is involved in anxiety- and perhaps depression-like behaviors and contribute to the analgesic effects of nicotine. PMID: 22573727
  9. mutation depressed fusion rates of alpha4beta4 receptor-containing vesicles with the plasma membrane by approximately 2-fold, with only a small decrease in the number of nAChRs per vesicle. The mutation also decreased the number of endoplasmic reticulum exit sites PMID: 21768117
  10. At higher doses, varenicline is an agonist of Chrnb4 producing physiological changes in mice. PMID: 22241831
  11. the present results indicate an important role for Chrna7 and Chrnb4 -containing nicotinic acetylcholine receptors in the anhedonic or somatic signs of nicotine withdrawal PMID: 22009521
  12. A mechanistic model provides sharpening of mitral cell receptive fields by activation of the alpha3beta4 subtype of nicotinic receptor, which could aid in odor discrimination and perceptual learning. PMID: 22378897
  13. This study demonstrated thatalpha3beta4alpha5 receptor-mediated mechanisms contributing to nicotine consumption, and identifies the medial habenula as a critical element in the circuitry controlling nicotine-dependent phenotypes. PMID: 21555077
  14. CA box is critical for beta4 promoter activity in vivo. PMID: 20696214
  15. Polymorphisms located within the Chrna5-Chrna3-Chrnb4 cluster on mouse chromosome 9 were found to co-segregate with alcohol preference, with high-drinking F(2) mice carrying B6 alleles and low-drinking F(2) mice carrying D2 alleles. PMID: 20496163
  16. beta 4 subunits are important components of nAChRs in autonomic ganglia. Deficiency of beta 4 subunits altered ion channel properties, conductance, and sensitivity and affinity of receptors to agonists and antagonists, affecting ganglionic transmission. PMID: 12606764
  17. Tests on beta4-knockout mice revealed beta4-containing nAChRs influence behavioral responses during anxiety-related tests, and that this effect depends on the type of anxiety-provoking experience PMID: 12867510
  18. Immunohistochemical analysis of nAChRbeta4 in the mouse brain suggests an extensive and potentially diverse role for this subunit in both excitatory and inhibitory neurotransmission. PMID: 14681928
  19. There is a a major role for beta4-containing nicotinic acetylcholine receptors in the appearance of nicotine withdrawal symptoms. PMID: 15537871
  20. The involvement of the beta4 nAChR subunit in both core body temperature homeostasis and nicotine-elicited thermo-alterations in mice. PMID: 15925141

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-4/CHRNB4 sub-subfamily
Tissue Specificity
Predominantly expressed by immature T-cells in the thymus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X