Recombinant Mouse Olfactory receptor 1044(Olfr1044)

Code CSB-CF837734MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8VGR9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MAQINCTQVTEFILVGLTDREELKMPLFVVFLSIYLFTTLGNLGLILVIRTDARLHTPMY FFLSNLAFVDFCYSSVITPKMLGNFLYKQNMISFNACAAQLGCFLAFMTAECLLLASMAY DRYVAICNPLLYMVLMSPGICFQLVAAPYSYSFLVALFHAILTFRLCYCHSNAINHFYCD DMPLLRLTCSDTHSKQLWIFVCAGIMFISSLLIVFISYTFIISAILRMRSAEGRRKAFST CGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDA LKKLIASKNQMLSS
Source in vitro E.coli expression system
Gene Names Olfr1044
Protein Names Recommended name: Olfactory receptor 1044 Alternative name(s): Olfactory receptor 185-4
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potential odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:259013

STRING: 10090.ENSMUSP00000097490

UniGene: Mm.223400

Related Products

Olfr1044 Proteins

Olfr1044 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.