Recombinant Mouse Olfactory receptor 494(Olfr494)

Code CSB-CF848701MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8VG07
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MAFLQDGNHTAVTEFILLGLTDGPILRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDMGLSSSVTPNMLVNFLVKQNTISYIACSIQFGLAAFFGTVECFLLAA MAYDRFVAICNPLLYSTKISTESCIQLVVGSYIGGFLNASSFILSFFSFIFCGPNRINHF YCDLAPLVELSCSDVSVSVVVTSFSAGSVTVITVFVIAVSYSYILITILKMHSTEGRHKA FSTCTSHLTAVTLYYGTITFIYVMPKSSYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KGAIKRQLGKKMFC
Source in vitro E.coli expression system
Gene Names Olfr494
Protein Names Recommended name: Olfactory receptor 494 Alternative name(s): Olfactory receptor 204-10
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potential odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:258732

STRING: 10090.ENSMUSP00000072810

UniGene: Mm.377662

Related Products

Olfr494 Proteins

Olfr494 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.