Recombinant Mouse PQ-loop repeat-containing protein 2(Pqlc2)

Code CSB-CF807463MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8C4N4
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MVWRTLGASNFSTCPNGSVQWIWDVFGECAQDGWDEASVGLGLVSILCFAASTFPQYIKA CKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLMMLTLYFHYK FKKRPSPLSAPINSVLLFILGTVCITPLLSSTDPVAVPREGFRGRTLLSVEPGNKPFTKK EVIGFVIGSASSLLYLLSRLPQIRTNFIRQSTQGISYSLFALVMLGNTLYGLSVLLKNPE VGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRSHETAAASEREPLLPS
Source in vitro E.coli expression system
Gene Names Pqlc2
Protein Names Recommended name: PQ-loop repeat-containing protein 2
Expression Region 1-293
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Amino acid transporter that specifically mediates the pH-dependent export of the cationic amino acids arginine, histidine and lysine from lysosomes.
Subcellular Location Lysosome membrane, Multi-pass membrane protein
Protein Families Laat-1 family
Tissue Specificity Ubiquitously expressed.
Database Links

KEGG: mmu:212555

UniGene: Mm.45131

Related Products

Pqlc2 Proteins

Pqlc2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.