Recombinant Mouse Palmitoyltransferase ZDHHC13 (Zdhhc13)

Code CSB-CF861477MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Zdhhc13
Uniprot No.
Alternative Names
Zdhhc13; Hip14l; Palmitoyltransferase ZDHHC13; Huntingtin-interacting protein 14-related protein; HIP14-related protein; Zinc finger DHHC domain-containing protein 13; DHHC-13
Species
Mus musculus (Mouse)
Expression Region
1-622
Target Protein Sequence
MEGPGLGSQCRNHSHGSHVPGFGRHGICVHENKELAKAKEILPLIEDSSNCDIVKATQYG IFERCKELVEAGYDVRQPDRENVSLLHWAAINNRLELVKFYISKGAVIDQLGGDLNSTPL HWAIRQGHLPMVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV NGQTPLMLSAYKVIGPEPTGFLLKFNPSLSVVDKTHQNTPLHWAVAAGNVSAVDKLLEAG SSLDIRNAKGETPLDMALQSKNQLISHMLRTEAKMRANKQFRLWRWLHKCELFLLLILSM ITLWAVGYILDFNSDSWLLKGCLLVALFFLTSLFPRFLVGYKNLVYLPTVFLLSSIFWIF MTWFILFFPDTAGSPLYFAFIFSIMAFLYFFYKTWATDPGFTKASEEERKVNIVTLAETG SLDFRTFCTSCLIRKPLRSLHCHVCNSCVARFDQHCFWTGRCIGFGNHHHYIFFLLSLSM VCDWIIYGSFVYWSNHCATTFKEDGLWTYLNQIVACSPWVLYIFMLAAFHFSWSTFLLIN QLFQIAFLGLTSHERISLLKQSRHMKQTLSLRKTPYNLGFTQNLADFFQCGCFGLVKPCI IDWTSQYTMVFHPAKEKVLRSV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates. Palmitoyltransferase for HTT and GAD2. May play a role in Mg(2+) transport.
Gene References into Functions
  1. The loss of ZDDHC13 in skin, impairs the multiple barrier functions and leads to a dermatitis lesion in response to microbial encounters. PMID: 28017833
  2. Homozygous Zdhhc13luc/Zdhhc13luc mice developed generalized hypotrichosis, associated with abnormal hair cycle, epidermal and sebaceous gland hyperplasia, hyperkeratosis, and increased epidermal thickness PMID: 26288350
  3. Data show that the ankyrin repeat (AR) domains of S-acyltransferases zDHHC17 and zDHHC13 recognize peptide sequence in several unrelated proteins. PMID: 26198635
  4. Zdhhc13 regulates Smad6 during BMP-dependent signaling and early lineage decisions in an in vitro cell model. PMID: 24702307
  5. Loss of Hip14 and Hip14l leads to early embryonic lethality at day embryonic day 10-11 due to failed chorioallantoic fusion. PMID: 25478910
  6. Zdhhc13 is a novel regulator of postnatal skeletal development and bone mass acquisition. PMID: 24637783
  7. Hip14l-deficient mice develop adult-onset, neuropathological deficits characteristic of Huntington disease. PMID: 23077216
  8. A second gene trap allele of Zdhhc13 has the same phenotypes, suggesting that this is a loss of function allele. PMID: 20548961
  9. huntingtin interacting protein genes, HIP14 and HIP14L, encode Mg2+ transport proteins that are regulated by their innate palmitoyl acyltransferases thus fulfilling the characteristics of "chanzymes." PMID: 18794299

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Protein Families
DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Tissue Specificity
Expressed in most adult tissues, but at low levels in the liver, skin, and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1