Recombinant Mouse Peroxisomal membrane protein 2(Pxmp2)

Code CSB-CF019109MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P42925
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence APAASRLRVESELGSLPKRALAQYLLLLKLYPVLTKAVSSGILSALGNLLAQTIEKKQRK DSRLLEVSGLLRYLVYGLFVTGPLSHYLYLFMEYSVPPEVPWASVKRLLLDRLFFAPTFL LLFFFVMNLLEGKNVSVFVAKMRSGFWPALQMNWRMWTPLQFININYVPLQFRVLFANMA ALFWYAYLASLGK
Source in vitro E.coli expression system
Gene Names Pxmp2
Protein Names Recommended name: Peroxisomal membrane protein 2 Alternative name(s): 22 kDa peroxisomal membrane protein
Expression Region 2-194
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.
Subcellular Location Peroxisome membrane, Multi-pass membrane protein
Protein Families Peroxisomal membrane protein PXMP2/4 family
Database Links

KEGG: mmu:19301

UniGene: Mm.21853

Related Products

Pxmp2 Proteins

Pxmp2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.