Recombinant Mouse Phosphatidylethanolamine N-methyltransferase (Pemt)

Code CSB-CF017780MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Pemt
Uniprot No.
Alternative Names
Pemt; Pempt; Pemt2; Phosphatidylethanolamine N-methyltransferase; PEAMT; PEMT; Phospholipid methyltransferase; PLMT
Species
Mus musculus (Mouse)
Expression Region
2-199
Target Protein Sequence
SWLLGYMDPTEPSFVAAVITIVFNPLFWNVVARWEQRTRKLSRAFGSPHLACYSLGICIL LLNILRSHCFTQAMMSQPKMEGLDNHTTYFLGLAFLGWGFVFVLSSFYALGFTGTFLGDY FGILKESRVTTFPFSVLDNPMYWGSTANYLGWALMHASPTGLLLTVVVAIVNVVALLYEE PFTAEIYRQKATRLHKRS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the three sequential steps of the methylation pathway of phosphatidylcholine biosynthesis, the SAM-dependent methylation of phosphatidylethanolamine (PE) to phosphatidylmonomethylethanolamine (PMME), PMME to phosphatidyldimethylethanolamine (PDME), and PDME to phosphatidylcholine (PC).
Gene References into Functions
  1. fenofibrate partially reversed hepatic steatosis and fibrosis in Pemt(-/-) mice when treatment was initiated after nonalcoholic fatty liver disease (NAFLD) had already been established. Increasing hepatic fatty acid oxidation can compensate for the lower VLDL-triacylglycerol secretion rate and prevent/reverse fatty liver disease in mice lacking PEMT. PMID: 28159867
  2. Results show that hepatic PEMT protein levels and activity are post-translationally repressed in homocystinuria and correlates with decreased phosphatidylcholine. PMID: 28291718
  3. Activation of PPARgamma using pioglitazone in high fat diet-fed Pemt(-/-) mice improved liver function, while these mice were still protected against diet-induced obesity and insulin resistance. PMID: 26797396
  4. Results showed that Pemt deficiency and high-fat diet in mouse model demonstrated the phenotypes resemble to the clinical features of the patients with lean non-alcoholic steatohepatitis. PMID: 26883167
  5. propose that cold-induced hypothermia in HF-fed Pemt(-/-) mice is linked to plasma hypoglycemia due to compromised hepatic glucose production. PMID: 26113536
  6. Lack of PEMT in mice does not promote fatty acid oxidation in skeletal muscle. PMID: 26603903
  7. Decreased lipogenesis in white adipose tissue may contribute to the resistance to diet-induced obesity in Pemt(-/-) mice. PMID: 25463480
  8. these findings indicate that the inhibition of Pemt activity ameliorates the ER stress associated with diabetic nephropathy in a model of type 1 diabetes PMID: 24667182
  9. This study evaluated the role of the role of phosphatidylethanolamine N-methyltransferase in hepatic carbohydrate metabolism in chow-fed mice. PMID: 24677714
  10. Pemt deficiency results in attenuated secretion of very low-density lipoproteins and homocysteine as well as in increased susceptibility to nonalcoholic liver disease. PMID: 22877991
  11. Lack of phosphatidylethanolamine N-methyltransferase decreased liver damage in Abcb4(-/-) mice caused by exposure of the liver to excess bile acids. PMID: 21292027
  12. Treatment strategies aimed at inhibition of PEMT might prevent the accumulation of cardiac triacylglycerol that predisposes individuals to compromised cardiac function. PMID: 21273556
  13. de novo synthesis of choline via PEMT has a previously unappreciated role in regulating whole body energy metabolism. PMID: 20452975
  14. During differentiation of 3T3-L1 cells to adipocytes, the amount of Sp1 protein decreased by approximately 50% just prior to activation of PEMT. PMID: 20150657
  15. Dietary docosahexaenoic acid supplementation modulates hippocampal development in the Pemt-/- mouse. PMID: 19889625
  16. PEMT is required in the secretion of apoB100-containing VLDLs. PMID: 12193594
  17. Results show that phosphatidylethanolamine N -methyltransferase (PEMT) knockout mice do not display normal concentrations of choline metabolites even with a supplemental source of dietary choline. PMID: 12466019
  18. Plasma homocysteine is regulated by phospholipid methylation, and is therefore lowered in enzyme-deficient mice. PMID: 12482759
  19. PEMT activity is involved in many physiologic processes including the flux of lipid between liver and plasma and the delivery of essential fatty acids to blood and peripheral tissues via the liver-derived lipoproteins PMID: 14608048
  20. This study observed increased numbers of phosphorylated histone H3 positive cells in the Pemt-/- mice (up 54% compared to wild-type mice; p<0.01). We also found decreased calretinin labeling in Pemt-/- (down to 43% compared to wild-type mice; p<0.01). PMID: 15063092
  21. deficiency causes severe liver damage in conjunction with choline-deficient diet PMID: 15164765
  22. Mouse PEMT genes have three unique transcription start sites, which are indicative of either multiple promoters and/or alternative splicing. PMID: 17456783
  23. We conclude that the biosynthesis of PC via the PEMT pathway is not quantitatively essential for biliary PC secretion under acute or chronic bile salt administration. PMID: 17595447
  24. Hepatic phosphatidylethanolamine N-methyltransferase has roles in animal biochemistry and physiology [review] PMID: 17881348
  25. PEMT is involved in the regulation of plasma HDL levels in mice, mainly via HDL lipid uptake by SR-BI. PMID: 18842588
  26. Lack of phosphatidylethanolamine N-methyltransferase alters plasma VLDL phospholipids and attenuates atherosclerosis in mice. PMID: 19520976

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Protein Families
Class VI-like SAM-binding methyltransferase superfamily, PEMT/PEM2 methyltransferase family
Tissue Specificity
Liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1