Recombinant Mouse Podoplanin(Pdpn)

Code CSB-CF017739MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q62011
Species Mus musculus (Mouse)
Sequence GTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKKDGLPVVTLVGIIVGVLLAIGFVGGIFIVVMKKISGRFSP
Source in vitro E.coli expression system
Gene Names Pdpn
Expression Region 23-172
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation
Subcellular Location Membrane, Single-pass type I membrane protein, Cell projection, lamellipodium membrane, Single-pass type I membrane protein, Cell projection, filopodium membrane, Single-pass type I membrane protein, Cell projection, microvillus membrane, Single-pass type I membrane protein, Cell projection, ruffle membrane, Single-pass type I membrane protein, Membrane raft, Apical cell membrane, Basolateral cell membrane, Cell projection, invadopodium
Protein Families Podoplanin family
Tissue Specificity Detected at high levels in lung and brain, at lower levels in kidney, stomach, liver, spleen and esophagus, and not detected in skin and small intestine. Expressed in epithelial cells of choroid plexus, ependyma, glomerulus and alveolus, in mesothelial ce
Database Links

KEGG: mmu:14726

STRING: 10090.ENSMUSP00000030317

UniGene: Mm.2976

Related Products

Pdpn Proteins

Pdpn Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.