Recombinant Mouse Potassium channel subfamily K member 1(Kcnk1)

Code CSB-CF012062MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O08581
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK RRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTRRPVLYFHIRWGFSKQVVA IVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDLVHIMEHDQLS FSSVTEQVAGLKEEQKQSEPFVASQSPPYEDGSADH
Source in vitro E.coli expression system
Gene Names Kcnk1
Protein Names Recommended name: Potassium channel subfamily K member 1 Alternative name(s): Inward rectifying potassium channel protein TWIK-1
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes, but also in kidney and in other tissues
Subcellular Location Cell membrane, Multi-pass membrane protein, Recycling endosome, Apical cell membrane, Cytoplasmic vesicle, Perikaryon, Cell projection, dendrite, Cell projection, Cell junction, synapse
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Detected in spiral ganglion neurons (PubMed:17079103). Detected in hippocampus CA1 and CA1 regions and in the molecular layer of the dentate gyrus (PubMed:24368895, PubMed:25406588). Detected on hippocampus astrocytes (PubMed:24368895, PubMed:24496152). H
Database Links

KEGG: mmu:16525

STRING: 10090.ENSMUSP00000046103

UniGene: Mm.10800

Related Products

Kcnk1 Proteins

Kcnk1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.