Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF012070MO |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P97438 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Mus musculus (Mouse) |
| Sequence | MAAPDLLDPKSAAQNSKPRLSFSSKPTVLASRVESDSAINVMKWKTVSTIFLVVVLYLII GAAVFKALEQPQEISQRTTIVIQKQTFIAQHACVNSTELDELIQQIVAAINAGIIPLGNS SNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQ LGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAVIFKHIEGWSALD AIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVIS KKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSVKRKLSAELAGNHNQ ELTPCRRTLSVNHLTSEREVLPPLLKAESIYLNGLTPHCAGEDIAVIENMK |
| Source | in vitro E.coli expression system |
| Gene Names | Kcnk2 |
| Protein Names | Recommended name: Potassium channel subfamily K member 2 Alternative name(s): Outward rectifying potassium channel protein TREK-1 TREK-1 K(+) channel subunit Two pore potassium channel TPKC1 |
| Expression Region | 1-411 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Ion channel that contributes to passive transmembrane potassium transport. Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner. In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2 |
| Subcellular Location | Isoform 1: Cell membrane, Multi-pass membrane protein |
| Protein Families | Two pore domain potassium channel (TC 1.A.1.8) family |
| Tissue Specificity | Detected in hippocampus astrocytes (at protein level) (PubMed:24496152). High expression in brain and lung. Also detected in kidney, heart and skeletal muscle. Not detected in liver. In the brain, highest expression in olfactory bulb, hippocampus and cere |
| Database Links |
KEGG: mmu:16526 STRING: 10090.ENSMUSP00000078416 UniGene: Mm.33304 |
Kcnk2 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP012070MO1 CSB-EP012070MO1 CSB-BP012070MO1 CSB-MP012070MO1 |
Recombinant Mouse Potassium channel subfamily K member 2(Kcnk2),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human UDP-glucuronosyltransferase 1-4(UGT1A4)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Electron transfer flavoprotein subunit alpha, mitochondrial(ETFA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Melanoma-associated antigen 10(MAGEA10)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Potassium-transporting ATPase subunit beta(ATP4B),Partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Visinin-like protein 1(VSNL1)
Express system: E.coli
Species: Homo sapiens (Human)
