Code | CSB-CF012070MO |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | Kcnk2 |
Uniprot No. | P97438 |
Species | Mus musculus (Mouse) |
Expression Region | 1-411 |
Target Protein Sequence | MAAPDLLDPKSAAQNSKPRLSFSSKPTVLASRVESDSAINVMKWKTVSTIFLVVVLYLII GAAVFKALEQPQEISQRTTIVIQKQTFIAQHACVNSTELDELIQQIVAAINAGIIPLGNS SNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQ LGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAVIFKHIEGWSALD AIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVIS KKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSVKRKLSAELAGNHNQ ELTPCRRTLSVNHLTSEREVLPPLLKAESIYLNGLTPHCAGEDIAVIENMK |
Protein Length | Full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Ion channel that contributes to passive transmembrane potassium transport. Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner. In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2 |
Subcellular Location | Isoform 1: Cell membrane, Multi-pass membrane protein |
Protein Families | Two pore domain potassium channel (TC 1.A.1.8) family |
Tissue Specificity | Detected in hippocampus astrocytes (at protein level) (PubMed:24496152). High expression in brain and lung. Also detected in kidney, heart and skeletal muscle. Not detected in liver. In the brain, highest expression in olfactory bulb, hippocampus and cere |
Database Links |
KEGG: mmu:16526 STRING: 10090.ENSMUSP00000078416 UniGene: Mm.33304 |
Recombinant Human Ornithine decarboxylase(ODC1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Myelin-associated glycoprotein(MAG),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Atrial natriuretic peptide receptor 1(NPR1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Lutropin-choriogonadotropic hormone receptor(Lhcgr),partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Collagen alpha-1(XVIII) chain(COL18A1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Thyrotropin subunit beta(Tshb)
Express system: Yeast
Species: Rattus norvegicus (Rat)