Product Details

Target Names

Kcna5

Uniprot No.

Q61762

Alternative Names

Kcna5; Potassium voltage-gated channel subfamily A member 5; Voltage-gated potassium channel subunit Kv1.5; KV1-5

Species

Mus musculus (Mouse)

Expression Region

1-602

Target Protein Sequence

MEISLVPMENGSAMTLRGGGEAGASCVQSPRGECGCPPTAGLNNQSKETSPRRRATHEDA GQGGRPLPPMPQELPQPRRPSAEDEEGEGDPGLGTVEEDQAPQDSGSLHHQRVLINISGL RFETQLGTLAQFPNTLLGDPVKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPV NVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSA RAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGANGSGSGVLSSG PTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDIVAIFPYF ITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASM RELGLLIFFLFIGVILFSSAVYFAEADNQGSHFSSIPDAFWWAVVTMTTVGYGDMRPITV GGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGIQRRESGLDTG GQRKVSCSKASFCKTGGPLESTDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRET DL

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation. Homotetrameric channels display rapid activation and slow inactivation. May play a role in regulating the secretion of insulin in normal pancreatic islets.

Gene References into Functions

KV1.5 channels predominantly associate with KVbeta1 and KVbeta2 proteins and that KVbeta2 performs a chaperone function for KV1.5 channels in arterial myocytes, thereby facilitating Kv1alpha trafficking and membrane localization. PMID: 28342889
The findings uncover detailed molecular mechanisms underpinning a channelopathy-linked form of atrial fibrillation and emphasize the inevitability of considering extracardiac mechanisms in genetic arrhythmia syndromes. PMID: 26985008
Silencing of Kv1.5 improved endothelium-dependent vasodilatation in thoracic aorta from type 2 diabetes mice. PMID: 26764232
Intracellular urate taken up by UATs enhanced Kv1.5 protein expression and function in HL-1 atrial myocytes. PMID: 26477273
KV1.5, a DPO-1-sensitive KDR channel, plays a major role in determining microvascular tone and the response to vasoconstrictors and vasodilators. PMID: 25808400
Kv1.5 channels in vascular smooth muscle play a critical role in coupling myocardial blood flow to cardiac metabolism. PMID: 26224794
the Kv1.5 subunit has a role in electrical remodeling of preoptic GABAergic neurons PMID: 24797243
MYO5A and MYO5B control functionally distinct steps in the surface trafficking of Kv1.5. PMID: 24508725
e-LXA4 promoted a modest upregulation of Kv1.5 mRNA that was suppressed by LPS or IL-4/IL-13. PMID: 24249731
The combined down-regulation of Kv4.2, Kv1.5 and KChIP2 prior to the onset of HF may play an important role in the premature sudden death in this DCM model. PMID: 22514734
cortactin was required for N-cadherin-mediated enhancement of Kv1.5 channel activity PMID: 21507952
Data confirm KCNA5 in left/right atria & indicate functional interaction of KCNA5 (ultra rapid) & KCNH2 (rapid). Action potentials are longer in right atrial myocytes than in left; this is due partly to smaller amplitude of KCNA5 in right atrium. PMID: 20826138
KChIP2 contributes to the formation of functional mouse ventricular Kv1.5 channels PMID: 15878168
hyperthyroidism resulted in more significant action potential shortening and greater delayed rectifier K(+) current increases in the right vs. the left atrium, which can contribute to the propensity for atrial arrhythmia in hyperthyroid heart PMID: 15894573
Our results show that Kcna5 promoter activity in vascular smooth muscle is critically dependent on Sp1 regulation via CACCC box motifs and identify mechanisms that potentially influence the expression of K(V)1.5 channel expression. PMID: 17660393
Kv1.5 has a role in Rab-GTPase-dependent endocytic recycling in atrial myocytes PMID: 17673464
These results suggest that the inhibition of K(v) channel expression and rise in [Ca(2+)](i) during chronic hypoxia may be the result of HIF-1-dependent induction of ET-1. PMID: 18065659
Antiarrhythmic drug-induced internalization of the atrial-specific k+ channel kv1.5. PMID: 19443837
Downregulation of Kv4.3 and Kv1.5 transcripts by estrogen are one mechanism defining gender-related differences in mouse ventricular repolarization. PMID: 19608983

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.5/KCNA5 sub-subfamily

Tissue Specificity

Highly expressed in heart and moderately in brain. Low levels in thymus, skeletal muscle and spleen. Not expressed in liver, lung or kidney.

Database Links

KEGG: mmu:16493

STRING: 10090.ENSMUSP00000055673

UniGene: Mm.222831

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF726758MO
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Potassium voltage-gated channel subfamily A member 5 (Kcna5)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage