Recombinant Mouse Potassium voltage-gated channel subfamily E member 1(Kcne1)

Code CSB-CF012025MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P23299
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MSLPNSTTVLPFLARLWQETAEQGGNVSGLARKSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKAVFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
Source in vitro E.coli expression system
Gene Names Kcne1
Protein Names Recommended name: Potassium voltage-gated channel subfamily E member 1 Alternative name(s): Delayed rectifier potassium channel subunit IsK Short name= mISK IKs producing slow voltage-gated potassium channel subunit beta Mink Minimal potassium
Expression Region 1-129
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr).
Subcellular Location Cell membrane, Single-pass type I membrane protein, Apical cell membrane, Membrane raft
Protein Families Potassium channel KCNE family
Tissue Specificity Restrictively localized in the apical membrane portion of epithelial cells.
Database Links

KEGG: mmu:16509

STRING: 10090.ENSMUSP00000052248

UniGene: Mm.299425

Related Products

Kcne1 Proteins

Kcne1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.