Recombinant Mouse Potassium voltage-gated channel subfamily E member 1 (Kcne1)

Code CSB-CF012025MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Kcne1
Uniprot No.
Alternative Names
Kcne1; Potassium voltage-gated channel subfamily E member 1; Delayed rectifier potassium channel subunit IsK; mISK; IKs producing slow voltage-gated potassium channel subunit beta Mink; Minimal potassium channel
Species
Mus musculus (Mouse)
Expression Region
1-129
Target Protein Sequence
MSLPNSTTVLPFLARLWQETAEQGGNVSGLARKSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKAVFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr).
Gene References into Functions
  1. SUMOylation of KCNQ1 is KCNE1 dependent and determines the native attributes of cardiac IKs in vivo. PMID: 28743749
  2. The electrophysiological effects of BACE1 on KCNQ1 reported here were independent of its enzymatic activity. PMID: 26454161
  3. KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation PMID: 26410412
  4. KCNE1 and KCNE2, auxiliary subunits of voltage-gated potassium channels, undergo sequential cleavage mediated by either alpha-secretase and presenilin(PS)/gamma-secretase or BACE1 and PS/gamma-secretase in cells. PMID: 23504710
  5. In clearance studies the KCNE1 knockout mice had an increased fractional excretion of Na+, Cl-, HCO3(-) and water. PMID: 21576273
  6. This study confirmed that KCNE1 channels are necessary for K+ secretion in developmental Saccule and Utricle in mice. PMID: 22090480
  7. Beta-adrenergic receptor-regulated I Ks channels can play a role in atrial fibrillation. PMID: 18006587
  8. both the voltage-dependence and kinetics of gating were found to depend on the relative densities of KCNQ1 and KCNE1, suggesting the heart rhythm may be regulated by the relative expression of the auxiliary subunit PMID: 20962273
  9. Findings directly implicate triggered electrical activity and spatial and temporal re-entrant mechanisms in the arrhythmogenesis observed in KCNE1 (-/-) hearts. PMID: 19430811
  10. intestinal Cl(-) secretion is independent from KCNE1 but requires KCNQ1 and in mouse pancreatic acini KCNQ1 probably co-assembled with KCNE1 leads to a voltage-dependent K(+) current that might be of importance for electrolyte and enzyme secretion. PMID: 11889581
  11. the spatial expression of minK-lacZ in the adult mouse heart has been shown, for the larger part, to be coincident with the conduction tissues PMID: 12741710
  12. The transitory transfection of kcne1 restores both Cl- and K+ swelling-activated currents, confirming the implication of KCNE1 protein in the cell-volume regulation in PCT cells in primary cultures. PMID: 12962276
  13. KCNE1 is associated with an arrhythmogenic phenotype that shows an increased dispersion of conduction velocities PMID: 14561835
  14. The HCO3- dependent regulatory volume decrease in isolated renal proximal tubule cells requires normal expression of KCNE1. PMID: 15123546
  15. analysis of the IsK/KvLQT1 potassium channel in a new corticosteroid-sensitive cell line derived from the inner ear PMID: 16478723
  16. Our findings suggest an important role for LIMP2 in the control of the localization and the level of apically expressed membrane proteins such as KCNQ1, KCNE1 and megalin in the stria vascularis. PMID: 16901941
  17. In juvenile mice, the KCNE1 mutation was associated with a strong decrease in the expression of the calcium-binding proteins calbindin, calretinin and parvalbumin within the medial vestibular nucleus PMID: 17627998
  18. these data indicate that KCNE1 and KCNE3 interact directly with Kv12.2 channels to regulate channel membrane trafficking PMID: 19623261

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Apical cell membrane. Membrane raft.
Protein Families
Potassium channel KCNE family
Tissue Specificity
Restrictively localized in the apical membrane portion of epithelial cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1