Recombinant Mouse Potassium voltage-gated channel subfamily KQT member 4(Kcnq4)

Code CSB-CF884939MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Kcnq4
Uniprot No. Q9JK97
Alternative Names Kcnq4; Potassium voltage-gated channel subfamily KQT member 4; KQT-like 4; Potassium channel subunit alpha KvLQT4; Voltage-gated potassium channel subunit Kv7.4
Species Mus musculus (Mouse)
Expression Region 1-696
Target Protein Sequence MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPG PGSGSGSACGGQRSSAAQKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLS TIQEHQELANECLLILEFVMIVVFGLEYIIRVWSAGCCCRYRGWQGRFRFARKPFCVIDF IVFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELI TAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVL AAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDTSR AYLTATWYYYDSILPSFRELALLFEHIQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCH RPGSASFCPGESSRMGIKDRIRISSSQKRTGPSKQHLAPPPIPTSPSSEQVGEASSPSKV QKSWSFNDRTRFRASLRLKPRCSAEEGPSEEVAEEKSYQCELTVDDVMPAVKTVIRSVRI LKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQARVDQIVGRGPGDRKTREK GDKGPSDTEAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGTVQVPL FDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probably important in the regulation of neuronal excitability. May underlie a potassium current involved in regulating the excitability of sensory cells of the cochlea.
Gene References into Functions
  1. we provide strong evidence that Kv7.4 channels are a key modulator of the excitability of VTA dopaminergic neurons, which contributes to the development of depressive behaviour PMID: 28885682
  2. is concluded that K(V)7 channels, via nifedipine sensitive channels, have a role in the regulation of basal renal vascular tone. PMID: 25965962
  3. Kv7.4 currents are inhibited in a CB1 pathway repressed by endocannabinoid 2-AG PMID: 24927567
  4. REST as a crucial transcriptional regulator for the Kv7.4 potassium channel subunit. PMID: 23242999
  5. analysis of the vestibular role of KCNQ4 and KCNQ5 K+ channels revealed by mouse models PMID: 23408425
  6. In 2 different rat and mouse models of hypertension, the functional impact of Kv7 channels was dramatically downregulated. PMID: 21747056
  7. Data show that in early pregnant mouse myometrium, the relative abundance of mRNA expression was KCNQ3 > KCNQ4 > KCNQ5 > KCNQ1 > KCNQ2. PMID: 20132415
  8. evidence of the cellular etiology and mechanisms of SGN degeneration in DFNA2. PMID: 20739290
  9. KCNQ channels set the resting membrane potential of inner hair cells in the isolated organ of Corti and maintain [Ca2+]i at low levels PMID: 12657673
  10. primary defect leading to high-frequency loss in DFNA2 patients may be attributable to high levels of the dysfunctional Kcnq4_v3 variant in the spiral ganglion and inner hair cells in the basal hook region PMID: 16207888
  11. Auditory function declined over several weeks in Kcnq4-/- mice and over several months in mice carrying the dominant negative allele. PMID: 16437162
  12. Analyses of vestibular hair cells (HCs) of Bdnf conditional mutant mice, which are devoid of any innervation, demonstrate that regulation of Kcnq4 expression in vestibular HCs is independent of innervation. PMID: 17292869
  13. Murine blood vessels exhibit a distinctive expression profile of KCNQ1, KCNQ4, and KCNQ5, with 'neuronal' KCNQ4 dominating PMID: 17519950
  14. variations within the C terminus of splice variants produce profound differences in the voltage-dependent phenotype and functional expression of the channel PMID: 17561493
  15. Results provide support for KCNQ4- or KCNQ5-encoded channels having an important functional impact in the vasculature. PMID: 18536747
  16. K(v)7.4 and K(v)7.5 are expressed in different regions of the murine gastrointestinal tract and blockers of K(v)7 channels augment inherent contractile activity. PMID: 19389803

Show More

Hide All

Subcellular Location Basal cell membrane; Multi-pass membrane protein. Note=Situated at the basal membrane of cochlear outer hair cells.
Protein Families Potassium channel family, KQT (TC 1.A.1.15) subfamily, Kv7.4/KCNQ4 sub-subfamily
Tissue Specificity In the inner ear expressed in the outer sensory hair cells of the cochlea and in type I hair cells of the vestibular organs. Also expressed in the postsynaptic membrane of the calyx nerve endings innervating type I cells. In the brain expressed in neurons
Database Links

KEGG: mmu:60613

STRING: 10090.ENSMUSP00000030376

UniGene: Mm.249977

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1