Recombinant Mouse Progestin and adipoQ receptor family member 3(Paqr3)

Code CSB-CF761453MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6TCG8
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPVSLKDNPYITDGYRAYLPSRLCI KSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCML CSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLA MILAVFFAQIHPSYLTQQWQRLRPIIFCSVSGYGVIPTLHWVWLNGGVSAPIVQDFAPRV IVMYVIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHVLAVVMLYWWHQSTVYVMQYRH SKPCPDYVSHL
Source in vitro E.coli expression system
Gene Names Paqr3
Protein Names Recommended name: Progestin and adipoQ receptor family member 3 Alternative name(s): Progestin and adipoQ receptor family member III Raf kinase trapping to Golgi Short name= RKTG
Expression Region 1-311
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Functions as a spatial regulator of RAF1 kinase by sequestrating it to the Golgi.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Database Links

KEGG: mmu:231474

STRING: 10090.ENSMUSP00000069324

UniGene: Mm.332505

Related Products

Paqr3 Proteins

Paqr3 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.