Recombinant Mouse Progestin and adipoQ receptor family member 6(Paqr6)

Code CSB-CF764896MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6TCG5
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MLSLKMPQLLRVHQVPRVFWEEGIMSGYRCPTSSALDCVLSSFQMTNETVNIWTHFLPTW YFLWRLLALGSPGFRADPYHLPLLVFLLPACLYPFASCCAHTFSSMSPRARHICYFLDYG ALSLYSLGCAFPYAAYSMPASWLHSRLHQLFVPAAALNSFLCTGLSCYSRFPELEYPGFS KALRTAAFAYPFLFDNLPLFYRLRLCWGGAHSCGRDALSSNHGYHLLCALLSGFLFAARL PERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLAVQEPTLGLGATVAT LSLAVIGNLFIIAAFTASLLRMPGPCPLLQGSPLEEGLQAKQQ
Source in vitro E.coli expression system
Gene Names Paqr6
Protein Names Recommended name: Progestin and adipoQ receptor family member 6 Alternative name(s): Progestin and adipoQ receptor family member VI
Expression Region 1-343
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(s) mediated pathway. Involved in neurosteroid inhibition of apoptosis. May be involved in regulating rapid P4 signaling in the nervous system. Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Database Links

KEGG: mmu:68957

STRING: 10090.ENSMUSP00000114166

UniGene: Mm.441486

Related Products

Paqr6 Proteins

Paqr6 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.