Recombinant Mouse Protein FAM176A(Fam176a)

Code CSB-CF852786MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q91WM6
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MKLPLSPSTEPVATEPLGMALLSSLLAAWSYISENPERAALYFVSGVCIGLFLTLAALVM RISCHTDCRRGPRRRCLQDRECSDSSDSEDGSEDTASDLSVRRHRRFERTLNKNVFTSAE ELERAQRLEERERIIREIWMNGQPEVPGTRSLNRYY
Source in vitro E.coli expression system
Gene Names Eva1a
Protein Names Recommended name: Protein FAM176A Alternative name(s): Transmembrane protein 166
Expression Region 1-156
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein, Lysosome membrane, Single-pass membrane protein
Protein Families EVA1 family
Database Links

KEGG: mmu:232146

STRING: 10090.ENSMUSP00000037422

UniGene: Mm.489683

Related Products

Eva1a Proteins

Eva1a Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.