Recombinant Mouse Receptor expression-enhancing protein 4(Reep4)

Code CSB-CF812955MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8K072
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MVSWMICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFIS WFPFYYEFKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDACIVQAKERSYETMLS FGKRSLNIAASAAVQAATKSQGALAGRLRSFSMQDLRSIPDTPVPTYQDPLYLEDQVPRR RPPIGYRPGGLQGSDTEDECWSDNEIVPQPPVRPREKPLGRSQSLRVVKRKPLTREGTSR SLKVRTRKKAMPSDMDS
Source in vitro E.coli expression system
Gene Names Reep4
Protein Names Recommended name: Receptor expression-enhancing protein 4
Expression Region 1-257
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families DP1 family
Database Links

KEGG: mmu:72549

STRING: 10090.ENSMUSP00000040162

UniGene: Mm.46742

Related Products

Reep4 Proteins

Reep4 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.