Recombinant Mouse Rhomboid domain-containing protein 2(Rhbdd2)

Code CSB-CF845017MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8VEK2
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MAAPGPASRFWCSCPEVPSATFFTALLSLLVSGPRLFLLQPPLAPSGLSLRSEALRNWQV YRLVTYIFVYENPVSLLCGAIIIWRFAGNFERTVGTVRHCFFTLIFTVFSAIIYLSFESV SSLSKLGEVEDARGFTPVAFAMLGVTSVRSRMRRALVFGVVVPSVLVPWLLLCASWLIPQ TSFLSNVSGLLIGLSYGLTYCYSLDLSERVALKLDQKFPFSLMRRIPLFKYISGSSAERR AAQSRRLNPAPGSYPTQSCHPHLTPSYPVTQMQHASGQKLASWPPGHMPSLPPYQPASGL CYVQNHFGPNPNASSVYPASAGTSQGVQPPSPISCPGTVYSGALGTPGATGSKESSKVAM P
Source in vitro E.coli expression system
Gene Names Rhbdd2
Protein Names Recommended name: Rhomboid domain-containing protein 2 Alternative name(s): Rhomboid-like protein 7
Expression Region 1-361
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Golgi apparatus, cis-Golgi network membrane, Multi-pass membrane protein
Protein Families Peptidase S54 family
Tissue Specificity Widely expressed, including in retina and brain (at protein level), as well as in kidney, testis and ovary. Expressed in all layers of the retina, including inner segments of photoreceptor cells and ganglion cells (at protein level).
Database Links

KEGG: mmu:215160

STRING: 10090.ENSMUSP00000049060

UniGene: Mm.295438

Related Products

Rhbdd2 Proteins

Rhbdd2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.