Recombinant Mouse Ring finger protein 26(Rnf26)

Code CSB-CF019883MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8BUH7
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MEAVYLVVNGVGLVLDLLTLMLDLNFLLVSSLLATLAWLLAFIYNLPHTVLTSLLHLGRG FLLSLLALVEAVVRFTFGGLQALGTLLYSCYSGLESLKLLGHLASHGALRSREFLNRGIL NMVSNGHALLRQACDICAIAMSLVAYVINSLVNICLISTQNFFSLVLALWDAVTGPLWRM TDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASCVVFHLTGLVLLACVLAV ILIVLHPEQTLRLATQALSQLHARPSYHRLWEDIVRLTRLPLGLEAWRRVWSRSLQLASW PNRGGAPGAPQGGPRRVFSARIQPQDTPPEAEEEVIRTAPARGREQLNEDEPAAGQDPWK LLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRSILQTL NVYL
Source in vitro E.coli expression system
Gene Names Rnf26
Protein Names Recommended name: Ring finger protein 26
Expression Region 1-424
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function E3 ubiquitin-protein ligase that plays a key role in endosome organization by retaining vesicles in the perinuclear cloud. Acts as a platform for perinuclear positioning of the endosomal system by mediating ubiquitination of SQSTM1. Ubiquitinated SQSTM1 attracts specific vesicle-associated adapters, forming a molecular bridge that restrains cognate vesicles in the perinuclear region and organizes the endosomal pathway for efficient cargo transport. Also acts as a regulator of type I interferon production in response to viral infection by mediating the formation of 'Lys-11'-linked polyubiquitin chains on TMEM173/STING, leading to stabilize TMEM173/STING. Also required to limit type I interferon response by promoting autophagic degradation of IRF3.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Database Links

KEGG: mmu:213211

UniGene: Mm.392032

Related Products

Rnf26 Proteins

Rnf26 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.