Recombinant Mouse Serine protease hepsin(Hpn)

Code CSB-CF010704MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O35453
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MAKEDEEPGAHRGGSTCSRPQPGKGGRTAACCSRPKVAALIVGTLLFLTGIGAASWAIVTILLQSDQEPLYQVQLSPGDSRLAVFDKTEGTWRLLCSSRSNARVAGLGCEEMGFLRALAHSELDVRTAGANGTSGFFCVDEGGLPLAQRLLDVISVCDCPRGRFLTATCQDCGRRKLPVDR
Source in vitro E.coli expression system
Gene Names Hpn
Protein Names Recommended name: Serine protease hepsin EC= 3.4.21.106 Cleaved into the following 2 chains: 1. Serine protease hepsin non-catalytic chain 2. Serine protease hepsin catalytic chain
Expression Region 1-181
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Serine protease that cleaves extracellular substrates, and contributes to the proteolytic processing of growth factors, such as HGF and MST1/HGFL. Plays a role in cell growth and maintenance of cell morphology. Plays a role in the proteolytic processing of ACE2 (By similarity). Mediates the proteolytic cleavage of urinary UMOD that is required for UMOD polymerization
Subcellular Location Apical cell membrane, Single-pass type II membrane protein, Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families Peptidase S1 family
Tissue Specificity Detected in kidney, in thick ascending tubule epithelial cells (at protein level) (PubMed:26673890). Detected in kidney and liver (PubMed:9395459, PubMed:9435303).
Database Links

KEGG: mmu:15451

STRING: 10090.ENSMUSP00000103737

UniGene: Mm.19182

Related Products

Hpn Proteins

Hpn Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.