Recombinant Mouse Small conductance calcium-activated potassium channel protein 3(Kcnn3)

Code CSB-CF012085MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Kcnn3
Uniprot No. P58391
Alternative Names Kcnn3; Sk3Small conductance calcium-activated potassium channel protein 3; SK3; SKCa 3; SKCa3; KCa2.3
Species Mus musculus (Mouse)
Expression Region 1-731
Target Protein Sequence MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQPPPPPAPPAVPQQPPGPLLQPQPPQ PQQQQSQQQQQQQSQQQQQAPLHPLPQLAQLQSQLVHPGLLHSSPTAFRAPTSANSTAIL HPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKY SGGVMKPLSRLSASRRNLIEAEPEGQPLQLFSPSNPPEIIISSREDNHAHQTLLHHPNAT HNHQHAGTTAGSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVI ETELSWGLYSKDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMTY ERIFYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIAR VMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRV CERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVA VVARKLELTKAEKHVHNFMMDTQLTKRIKNAATNVLRETWLVYKHTKLLKKIDHAKVRKH QRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLE SKLEHLTASFNSLPLLIADTLRQQQQQLLTAFVEARGISVAVGTSHAPPSDSPIGISSTS FPTPYTSSSSC
Protein Length Full length protein
Tag Info The following tags are available.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin (By similarity).
Gene References into Functions
  1. the present study shows that KCa2.3 channels are located in the apical plasma membrane of endothelial cells, and occasionally at inter-endothelial junctions of the corpus cavernosum. We found that down-regulation of these channels increases norepinephrine contraction in corpus cavernosum strips, and it seems associated with erectile dysfunction. PMID: 28630432
  2. SK3 signaling microdomain modulates endothelial Ca(2+) dynamics, vascular tone, and blood pressure. SK3 knockout mice are hypertensive. PMID: 26945080
  3. The data of this study implicated the family of KCNN genes in alcohol, nicotine, and drug addiction, and identify KCNN3 as a mediator of voluntary and excessive alcohol consumption PMID: 25662840
  4. ovariectomy leads to a reduction in endothelial SK3 channel activity thereby reducing the SK3 contribution to endothelium-dependent hyperpolarization vasorelaxation. PMID: 25105912
  5. Pulmonary hypertension in wild type mice and animals with genetic deficit in KCa2.3 and KCa3.1 channels PMID: 24858807
  6. SK3 channel modulates placental vascular development and fetal health by altering VEGF signaling. PMID: 25249506
  7. SK3 is functionally expressed in the distal nephron and collecting ducts where induction of TRPV4-mediated Ca2+ influx activates the channel. PMID: 24762817
  8. Reduced SK3 expression attenuates endometrial cell migration and is associated with unsuccessful pregnancy outcomes. PMID: 24978672
  9. SK3 channel contributes importantly towards atrial action potential repolarization. PMID: 24282291
  10. Overexpression of the SK3 channel causes an increased risk of sudden death associated with bradyarrhythmias and heart block, possibly due to atrioventricular nodal dysfunction. PMID: 24296650
  11. SK3-mediated [Ca(2+)]i elevation and membrane potential hyperpolarization in trophectoderm cells are important for blastocyst hatching. PMID: 22416006
  12. The results established that the SK3 channel contributes to both maternal and fetal outcomes during pregnancy. PMID: 22785240
  13. We found that the calcium-activated potassium channel SK3 and the G protein-activated potassium channel GIRK are part of an independent pathway for vomeronasal organ activation PMID: 22842147
  14. The results showed that SK3 channels undergo Ca2+-dependent cycling between the plasma membrane and intracellular organelles; disrupting Ca2+-dependent endothelial caveolae cycling abolishes SK3 channel trafficking. PMID: 22621787
  15. Findings indicate that Sp1 and Sp3 compete to regulate SK3 channel expression during pregnancy in response to stimulation by estrogen. PMID: 20682843
  16. Data support the concept that endothelial hyperpolarization through activation of SK3 contributes to exercise hyperemia and the hyperpolarization ascends the vascular tree through gap junctions formed by Cx40 to orchestrate dilation. PMID: 20427707
  17. these findings reveal a previously unknown function of the SK3/KCa2.3 channel in epithelial colonic cells, and suggest that Apc is a powerful regulator SK3/KCa2.3 channel. PMID: 20519134
  18. Formation of cellular projections in neural progenitor cells depends on SK3 channel activity. PMID: 17459146
  19. Endothelial SK3 channels exert a profound, tonic, hyperpolarizing influence in resistance arteries and suggest that the level of SK3 channel expression in endothelial cells is a fundamental determinant of vascular tone and blood pressure PMID: 12805243
  20. these channels have a significant role in the control of non-voiding contractions of the urinary bladder in vivo PMID: 12813145
  21. Elevated expression of small-conductance Ca2+-activated K+ channels of the SK3 type in hippocampi of aged mice contributes to reduced long-term potentiation and impaired learning. PMID: 12883553
  22. SK3-like immunoreactivity is rather complementary and predominantly detected in phylogenetically older brain regions like basal ganglia, thalamus, and various brain stem nuclei (e.g., locus coeruleus, tegmental nuclei). PMID: 15234350
  23. SK3 channels play an important role in regulating uterine function by limiting influx through L-type Ca(2+) channels and disrupting the development of concerted phasic contractile events. PMID: 17296820
  24. Endogenous ADMA may be an important factor for down-regulation of the expression of endothelial SK3 in atherosclerotic animals. PMID: 17869187
  25. Results indicate that intracellular calcium can both activate and block IK(Ca)(Kccn4) and SK(Ca) (Kcnn3)channels in endothelial cells, and that these channels regulate the resting membrane potential and intracellular calcium in native endothelium. PMID: 18195387
  26. Calcium-activated potassium channel protein 3.1 (KCa3.1) is required for such calcium ion-dependent processes as endothelin-1- or antigen-induced degranulation of mast cells, and may thus play a critical role in anaphylactic reactions. PMID: 18523267
  27. In summary, we report that SK3 deficiency leads to enhanced DA and 5-HT neurotransmission accompanied by distinct alterations in emotional behaviors. PMID: 18616612
  28. endothelial SK3 and IK1 channels have distinct stimulus-dependent functions, are major players in the EDHF pathway, and significantly contribute to arterial blood pressure regulation. PMID: 19380617
  29. The biological substrate for the cognitive impairments in SK3 knockout mice could conceivably entail reduced trophic support of the hippocampus. PMID: 19482064

Show More

Hide All

Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Potassium channel KCNN family, KCa2.3/KCNN3 subfamily
Tissue Specificity Expressed at low levels in atrial and ventricular myocytes (at protein level).
Database Links

KEGG: mmu:140493

STRING: 10090.ENSMUSP00000000811

UniGene: Mm.120250

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1