Recombinant Mouse Solute carrier family 22 member 3 (Slc22a3)

Code CSB-CF892978MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Slc22a3
Uniprot No.
Alternative Names
Slc22a3; Oct3; Solute carrier family 22 member 3; Organic cation transporter 3
Species
Mus musculus (Mouse)
Expression Region
1-551
Target Protein Sequence
MPTFDQALRKAGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGSQPDYYWCRGPRATALA ERCAWSPEEEWNLTTPELHVPAERRGQGHCHRYLLEATNTSSELSCDPLTAFPNRSAPLV SCSGDWRYVETHSTIVSQFDLVCSNAWMLDLTQAILNLGFLAGAFTLGYAADRYGRLIIY LISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGKGAWMTCFVIVTEIVGSKQRRIVGIV IQMFFTLGIIILPGIAYFTPSWQGIQLAISLPSFLFLLYYWVVPESPRWLITRKQGEKAL QILRRVAKCNGKHLSSNYSEITVTDEEVSNPSCLDLVRTPQMRKCTLILMFAWFTSAVVY QGLVMRLGLIGGNLYIDFFISGLVELPGALLILLTIERLGRRLPFAASNIVAGVSCLVTA FLPEGIPWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAP FLLFRLAAIWLELPLIIFGILASVCGGLVMLLPETKGIALPETVEDVEKLGSSQLHQCGR KKKTQVSTSDV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates potential-dependent transport of a variety of organic cations. May play a significant role in the disposition of cationic neurotoxins and neurotransmitters in the brain.
Gene References into Functions
  1. Study is the first to examine the subcellular localization of organic cation transporter 3 (OCT3) in any tissue, and the first to explore its spatial relationship to synaptic structures in the brain. Study suggests that OCT3 not only contributes to the clearance of extracellular monoamines, but also plays a role in their intracellular disposition and action. PMID: 27659446
  2. Metformin undergoes negligible metabolism, these results imply that intestinal absorption of metformin is mediated at least in part by Oct3 in mice. PMID: 27569291
  3. Study showed that few, if any, 5-HT neurons in the dorsal raphe are resistant to loss of Pet-1 for expression of Slc22a3 PMID: 25642596
  4. Findings suggest that OCT3 plays an important role in the absorption and elimination of metformin and that the transporter is a critical determinant of metformin bioavailability, clearance, and pharmacologic action. PMID: 25920679
  5. These results demonstrate that OCT3 is responsible for metformin accumulation and secretion in salivary glands. PMID: 25107910
  6. evidence for a new means of downregulating IL-4 production by basophils, both in vitro and in vivo, through OCT3 targeted by 5-HT and pharmacologic ligands. PMID: 21636115
  7. these results show that reduced 5-HT clearance following HPA axis activation is likely mediated, at least in part, by the corticosterone-sensitive OCT3 PMID: 21068324
  8. Slc22a3 is one of three imprinted genes on chromosome 17 that is expressed from the maternal allele. A non-coding Air RNA is required for repression of all three genes on the paternal allele. PMID: 11845212
  9. In 5HT transporter-deficient mice, OCT3 mRNA concentrations were significantly increased in the hippocampus, but not in other brain regions PMID: 12584728
  10. Imprinted silencing of Slc22a3 does not need transcriptional overlap between Igf2r and Air. PMID: 12853484
  11. OCT3 is critical for the balanced neural and behavioral responses to environmentally induced variations in osmolarity and important for CNS function PMID: 15028779
  12. STAT3 and Oct3/4, essential transcription factors for ES cell self-renewal, are involved in the regulation of Dax1 expression. PMID: 18471437
  13. OCT3 plays a role in the homeostatic regulation of aminergic neurotransmission in the brain. PMID: 18513366
  14. findings show Air interacts with the Slc22a3 promoter chromatin & the H3K9 histone methyltransferase G9a in placenta; Air accumulates at the Slc22a3 promoter in correlation with localized H3K9 methylation & transcriptional repression PMID: 18988810
  15. Results suggest that organic cation transporter type 3 may be an important transporter mediating serotonergic signaling when serotonin transporter expression or function is compromised. PMID: 19033200
  16. a role of OCT3 in the regulation of fear and anxiety PMID: 19280114

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Tissue Specificity
Highly expressed in placenta and in kidney cortex, but not in medulla. Low levels found in brain. In the kidney, expressed specifically in the proximal and distal convoluted tubules and within Bowman capsule, but not in the glomerulus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X