Recombinant Mouse Synaptotagmin-2 (Syt2)

Code CSB-CF023038MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Syt2
Uniprot No.
Alternative Names
Syt2; Synaptotagmin-2; Inositol polyphosphate-binding protein; IP4-binding protein; IP4BP; Synaptotagmin II; SytII
Species
Mus musculus (Mouse)
Expression Region
1-422
Target Protein Sequence
MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Exhibits calcium-dependent phospholipid and inositol polyphosphate binding properties. May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. Plays a role in dendrite formation by melanocytes.; (Microbial infection) Receptor for C.botulinum neurotoxin type B (BoNT/B, botB); interaction is improved in the presence of gangliosides. The toxin binds via the vesicular domain (residues 47-60).; (Microbial infection) Receptor for C.botulinum neurotoxin type G (BoNT/G, botG); gangliosides are not required for (or only very slightly improve) binding to a membrane-anchored receptor fragment. The toxin binds via the vesicular domain (residues 47-55).
Gene References into Functions
  1. Authors propose that the strong reduction of Syt2 and SV2B are key factors of the functional synaptic alteration and that the physiological downregulation of Syt1 plays a determinant role in muscle vulnerability in SMA PMID: 28173138
  2. Deletion of Syt2 severely reduced and delayed disynaptic inhibition following parallel fiber stimulation and as release sensor at GABAergic basket cell-Purkinje cell synapses ensures fast and efficient feedforward inhibition in cerebellar microcircuit. PMID: 28099850
  3. aM inhibitors or the inhibition of the Ca(2+)-calmodulin-Munc13-1 signaling pathway only impaired the uptake of Syt2 while leaving membrane retrieval intact, indicating different recycling mechanisms for membranes and vesicle proteins. Our data identify a novel mechanism of stimulus- and Ca(2+)-dependent regulation of coordinated endocytosis of synaptic membranes and vesicle proteins. PMID: 27154627
  4. The 2.3-A structure of a ternary complex of botulinum neurotoxin type B bound to both its protein receptor synaptotagmin II and its ganglioside receptor GD1a, is reported. PMID: 23807078
  5. Syt2 make it an excellent marker for analyzing the development and plasticity of perisomatic inhibitory innervations onto both excitatory and inhibitory neurons in the visual cortex. PMID: 22539967
  6. Syt2 increases the dynamic range of synapses by driving release with a high Ca(2)+ cooperativity, as well as by suppressing a remaining, near-linear Ca(2)+ sensor. PMID: 21338883
  7. Transient expression of Syt2 is no longer detected in cochlear inner hair cells (IHCs) after the onset of hearing, indicating that the most common calcium-sensors in central nervous system synapses are not involved in mature IHC ribbon synapse. PMID: 20926654
  8. SYT2 was a negative regulator of chemotaxis PMID: 20473299
  9. Synaptotagmins I and II act as nerve cell receptors for botulinum neurotoxin G PMID: 15123599
  10. The readily releasable pool was rescued by Syt2 overexpression. The kinetics of fusion was slightly slower than in cells expressing Syt1. Syt2 has a lower Ca2+ affinity for phospholipid binding than Syt1 because of a difference in the C2A domain. PMID: 16407561
  11. Data suggest that synaptotagmins 1 and 2 perform equivalent functions in the Ca2+ triggering of action potential-induced neurotransmitter release and in the restriction of spontaneous release. PMID: 16642042
  12. Synaptotagmin-2 is an essential synaptotagmin isoform that functions in concert with other synaptotagmins in the calcium-ion triggering of neurotransmitter release. PMID: 17192432
  13. Data show that lack of Synaptotagmin-2 in mast cells was not associated with increased spontaneous exocytosis. PMID: 19473977

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm.
Protein Families
Synaptotagmin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1