Recombinant Mouse Synaptotagmin-4 (Syt4)

Code CSB-CF023040MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Syt4
Uniprot No.
Alternative Names
Syt4; Syt3; Synaptotagmin-4; Synaptotagmin IV; SytIV
Species
Mus musculus (Mouse)
Expression Region
1-425
Target Protein Sequence
MAPITTSRVEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRRSAKSNKTPPYKFVHVLKGVDIYPENLSSKKKFGGDDKSEVKGKAALPNLSLHLDLEKRDLNGNFPKANPKAGSSSDLENVTPKLFTETEKEANSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHRVKTRVLRKTLDPVFDETFTFYGIPYPHIQELSLHFTVLSFDRFSRDDVIGEVLIPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Synaptotagmin family member which does not bind Ca(2+). Plays a role in dendrite formation by melanocytes.; Synaptotagmin family member which does not bind Ca(2+). Involved in neuronal dense core vesicles (DCVs) mobility through its interaction with KIF1A. Upon increased neuronal activity, phosphorylation by MAPK8/JNK1 destabilizes the interaction with KIF1A and captures DCVs to synapses. Plays a role in dendrite formation by melanocytes.
Gene References into Functions
  1. Syt4 Overexpression Represses Basal Insulin Secretion and Impairs Islet Morphogenesis. PMID: 29656931
  2. BDNF secretion mediated by syt-IV is subject to extensive temporal and spatial control to modulate the spatial pattern of synaptic efficacy in networks of neurons PMID: 22514304
  3. Somatodendritic dopamine release requires synaptotagmin 4 and 7 and the participation of voltage-gated calcium channels. PMID: 21576241
  4. these data suggest that syt IV plays a role both in the Golgi and in the maintenance of normal numbers of synaptic vesicles in presynaptic terminals PMID: 20138128
  5. propose that Syt IV is essential for the regulated release of glutamate from astrocytes and is a candidate Ca2+ sensor for gliotransmission by these nonneuronal cells PMID: 15197251
  6. Syt IV plays a role in rodent mood-related behavior by regulating synaptic function in the neuronal networks that modulate these behaviors. PMID: 15380377
  7. Syt IV is a presynaptic negative regulator of short-term plasticity in area CA1 of the hippocampus and is required for some, but not all, forms of hippocampus-dependent memory. PMID: 15390175
  8. Given the neuroendocrine functions of the posterior pituitary, changes in Syt IV levels could be involved in endocrine transitions involving alterations in the release of the neuropeptides oxytocin and vasopressin PMID: 19136969
  9. Thus, regulation of BDNF secretion by syt-IV emerges as a mechanism for maintaining synaptic strength in a useful range during LTP. PMID: 19448629
  10. From the results of this study the author proposed that the differential expression of synaptotagmins determines the characteristic Ca2+ sensitivity of vesicle fusion at hair cell synapses. PMID: 20010821

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, neuronal dense core vesicle membrane; Single-pass membrane protein.
Protein Families
Synaptotagmin family
Tissue Specificity
Expressed in many regions of the nervous system but is undetectable in extra neural tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1