Recombinant Mouse Taste receptor type 2 member 140(Tas2r140)

Code CSB-CF756028MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7TQA4
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MNATVKCTLLIILGVEIIIGCLGNGFIAVVNIMDWAKRRKISLVDQIFTALAISRLAFVW SLLTVLFTSELYSALMTTRKVLIIFNNSWTVINHFNIWLATCLSIFYFLMIANFSNSIFL SLRWRVKTVVSVTLLMSLLLLFVNVLVINTFIVISVDVYKVNTSYSSHSDNNIHISRIFL FTNTIFTFIPFSVTLTIFLLLIFSLWTHLKNMQHNAKDSRDPSTTAHIKALQMMVTFLLL YTIFFLALVMQSSKMKFLSSTVFNYFFEVISLAFPSGHSCVLILGNSKLRQTFISTVWWL KSSFNAAELPGP
Source in vitro E.coli expression system
Gene Names Tas2r140
Protein Names Recommended name: Taste receptor type 2 member 140 Short name= T2R140 Alternative name(s): T2R13 T2R8 Taste receptor family B member 3 Short name= mTRB3 Short name= mTRB5 Taste receptor type 2 member 40 Short n
Expression Region 1-312
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor T2R family
Tissue Specificity Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in 15% taste bud cells in circumvallate and foliate papillae but only in 2% in fungiform papillae.
Database Links

KEGG: mmu:387616

STRING: 10090.ENSMUSP00000093040

UniGene: Mm.422613

Related Products

Tas2r140 Proteins

Tas2r140 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.