Recombinant Mouse Trace amine-associated receptor 4(Taar4)

Code CSB-CF735572MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5QD15
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MNTPDPWSSPEVQFCFAAANSSCPRKARPALVVCAMYLIMIGAIVMTMLGNMAVIISIAH FKQLHSPTNFLILSMATTDFLLSCVVMPFSMIRSIESCWYFGDLFCKVHSCCDIMLCTTS IFHLCFISVDRHYAVCDPLHYVTQITTRVVGVFLLISWSVPIFFAFGLVFSELNLIGAED FVAAIDCTGLCVLIFNKLWGVLASFIAFFLPGTVMVGIYIHIFTVAQKHARQIGTGPRTK QALSESKMKATSKKESKATKTLSIVMGVFVLCWLPFFVLTITDPFIDFTTPEDLYNVFLW LGYFNSTFNPIIYGMFYPWFRKALRMIVTGTIFRSDSSTSSLHPAHP
Source in vitro E.coli expression system
Gene Names Taar4
Protein Names Recommended name: Trace amine-associated receptor 4 Short name= TaR-4 Short name= Trace amine receptor 4
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Olfactory receptor specific for 2-phenylethylamine, a trace amine present at high concentration in the urine of carnivore species, playing a key role in fear and avoidance responses. 2-phenylethylamine acts as a kairomone in the chemical detection of carnivore odor and triggers fear in mice. This receptor is probably mediated by the G(s)-class of G-proteins which activate adenylate cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Specifically expressed in neurons of the olfactory epithelium, to discrete glomeruli predominantly localized to a confined bulb region. Present in the dorsal area of the main olfactory epithelium.
Database Links

KEGG: mmu:209513

STRING: 10090.ENSMUSP00000090330

UniGene: Mm.300612

Related Products

Taar4 Proteins

Taar4 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.