Recombinant Mouse Transient receptor potential cation channel subfamily V member 3 (Trpv3)

Code CSB-CF817002MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Trpv3
Uniprot No.
Alternative Names
Trpv3; Transient receptor potential cation channel subfamily V member 3; TrpV3
Species
Mus musculus (Mouse)
Expression Region
1-791
Target Protein Sequence
MNAHSKEMAPLMGKRTTAPGGNPVVLTEKRPADLTPTKKSAHFFLEIEGFEPNPTVTKTS PPIFSKPMDSNIRQCLSGNCDDMDSPQSPQDDVTETPSNPNSPSANLAKEEQRQKKKRLK KRIFAAVSEGCVEELRELLQDLQDLCRRRRGLDVPDFLMHKLTASDTGKTCLMKALLNIN PNTKEIVRILLAFAEENDILDRFINAEYTEEAYEGQTALNIAIERRQGDITAVLIAAGAD VNAHAKGVFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMENEQTDITSQDSRGNNIL HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETMRNNDGLTPLQLAAKMGKAEILKYI LSREIKEKPLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEIIVYNTNIDNRHEML TLEPLHTLLHTKWKKFAKYMFFLSFCFYFFYNITLTLVSYYRPREDEDLPHPLALTHKMS WLQLLGRMFVLIWATCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFVQAVLVILSVFLY LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYILFLLG FGVALASLIEKCSKDKKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSTYPILFLFLLIT YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL CKVADEDFRLCLRINEVKWTEWKTHVSFLNEDPGPIRRTADLNKIQDSSRSNSKTTLYAF DELDEFPETSV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Putative receptor-activated non-selective calcium permeant cation channel. It is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. Activation exhibits an outward rectification. May associate with TRPV1 and may modulate its activity. Is a negative regulator of hair growth and cycling: TRPV3-coupled signaling suppresses keratinocyte proliferation in hair follicles and induces apoptosis and premature hair follicle regression (catagen).
Gene References into Functions
  1. results demonstrate that carvacrol from plant oregano is a skin sensitizer or allergen; TRPV3 is involved in the initial phase and the sustained phase of pruritus, whereas TRPA1 likely contributes to the initial phase. PMID: 29094727
  2. TRPV3 is involved in the development of ear edema caused by arachinonic acid. PMID: 28515378
  3. It was concluded that TRPV3 is expressed in a discrete subpopulation of vagal afferent neurons and may contribute to vagal afferent signaling either directly or in combination with TRPV1. PMID: 26843581
  4. findings suggest that although TRPV3 agonism induces hypothermia in rodents, it may have a limited potential as a novel pharmacological method for induction of hypothermia PMID: 26528923
  5. TRPV3 activation led to a decrease in embryonic stem cell proliferation. Cell cycle analysis revealed that TRPV3 activation increased the percentage of cells in G2/M phase. PMID: 26130157
  6. Study illustrates the antiadipogenic role of TRPV3 in the adipocytes. PMID: 25774551
  7. Investigated the role of TRPV3 to wound healing using a tooth extraction model and found that oral wound closure was delayed in TRPV3KO compared with that in WT. TRPV3 mRNA was up-regulated in wounded tissues, so TRPV3 may contribute to oral wound repair. PMID: 25351988
  8. Demonstrate similarities but also notable differences in TRPV3 pharmacology between recombinant and native systems. PMID: 23848361
  9. a gain-of-function mutation in TRPV3 (TRPV3Gly573Ser) shows that increasing skin temperature is associated with the modulation of dermal dendritic cells PMID: 24164484
  10. TRPV3-ARD with characteristic finger 3 loop likely plays an important role in channel function and pharmacology. PMID: 24248473
  11. This study demonistrated that Loss of interneuron long-term depression and attenuated pyramidal cell long-term potentiation in Trpv3 knockout mice PMID: 23536486
  12. temperature-dependent conformations of single amino acids in TRP channels PMID: 23555720
  13. Responses to camphor were totally lost in mTRPV3-C619S mutant. PMID: 23625413
  14. The findings suggest that epidermal TRPV3 is tonically inhibited by both extracellular and intracellular Mg(2+), which act on both sides of the channel pore loop. PMID: 22622423
  15. TRPV3 is a therapeutic target for itch PMID: 22475759
  16. TRPV3 regulates nitric oxide synthase-independent nitric oxide synthesis in the skin. PMID: 21712817
  17. TRPV3 and TRPV4 likely make limited and strain-dependent contributions to innocuous warm temperature perception or noxious heat sensation PMID: 21586160
  18. Study shows that keratinocyte TRPV3 forms a signaling complex with TGF-alpha/EGFR; activation of EGFR leads to increased TRPV3 channel activity, which in turn stimulates TGF-alpha release; TRPV3 is also required for the formation of the skin barrier. PMID: 20403327
  19. specifically expressed in keratinocytes;hence,skin cells are capable of detecting heat via molecules similar to those in heat-sensing neurons PMID: 12016205
  20. TRPV3 and TRPV4 are ion channels activated by modest increases in ambient temperature. PMID: 15004014
  21. activated by heat and expressed in keratinocytes; has a specific role in thermosensation; camphor proved to be a specific activator of TRPV3 PMID: 15746429
  22. TRPV3 was the gene responsible for Nh and Ht mutations, and mutation in TRPV3 possibly correlated with increased mast cell numbers. PMID: 16858425
  23. Data suggest that the G573S and G573C substitutions render the TRPV3 channel spontaneously active under normal conditions, which in turn alters ion homeostasis and membrane potentials of skin keratinocytes, leading to hair loss and skin diseases. PMID: 17706768
  24. Regulation of TRPV3 appears to be important for appropriate hair development in rodents. PMID: 17888882
  25. Ca(2+) inhibits TRPV3 from both the extracellular and intracellular sides. The inhibition is sequentially reduced, appearing as sensitization to repetitive stimulations. PMID: 18178557
  26. TRPV3(Gly573Ser) is a cause of pruritus and/or dermatitis associated with scratching, and TRPV3 may represent a therapeutic target in pruritic dermatitis PMID: 18754035
  27. Our results reveal a previously undescribed mechanism for keratinocyte participation in thermal pain transduction through keratinocyte TRPV3 ion channels and the intercellular messenger PGE(2). PMID: 19091963
  28. vanilloid type 3 (TRPV3) channel is crucially involved in pruritic dermatitis [review] PMID: 19209153
  29. TRPV3 is present in absorptive cells in the distal colon and may be involved in a variety of cellular functions. PMID: 19336223
  30. we observed that heat-activated keratinocytes secretes ATP, and that ATP release is compromised in keratinocytes from TRPV3-deficient mice. This study provides evidence that ATP is a messenger molecule for mainly TRPV3-mediated thermotransduction in skin. PMID: 19669158
  31. TRPV-3 was found to be localized in the mouse olfactory and respiratory epithelium. It may act as chemoesthetic receptor and play a role in allergic rhinitis. PMID: 19839244

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV3 sub-subfamily
Tissue Specificity
Expressed in keratinocytes and hair follicles.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1