Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF023887MO |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q9CZX9 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Mus musculus (Mouse) |
| Sequence | MTTQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQET DRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATF KMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGG LLL |
| Source | in vitro E.coli expression system |
| Gene Names | Emc4 |
| Protein Names | Recommended name: Transmembrane protein 85 |
| Expression Region | 1-183 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | May mediate anti-apoptotic activity. |
| Subcellular Location | Membrane, Multi-pass membrane protein |
| Protein Families | EMC4 family |
| Database Links |
KEGG: mmu:68032 STRING: 10090.ENSMUSP00000028551 UniGene: Mm.220942 |
Emc4 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP023887MO1 CSB-EP023887MO1 CSB-BP023887MO1 CSB-MP023887MO1 |
Recombinant Mouse Transmembrane protein 85(Tmem85),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Naja kaouthia Cobra venom factor,partial
Express system: E.coli
Species: Naja kaouthia (Monocled cobra) (Naja siamensis)
-SDS.jpg)
Recombinant Human Versican core protein(VCAN),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Bone marrow proteoglycan(PRG2),partial
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Human Transcription factor PU.1(SPI1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Neuroendocrine convertase 2(Pcsk2)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Methionine aminopeptidase 2(METAP2)
Express system: E.coli
Species: Homo sapiens (Human)
