Recombinant Mouse Transmembrane protein adipocyte-associated 1(Tpra1)

Code CSB-CF859567MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99MU1
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MASLQEANGSTAWPPPTASNISEPHQCLLLLYEDIGSSRVRYWDLLLLIPNVLFFIFLLW KLPLARAKIRVTSSPIFITFYILVFVVALVGIARAVVSMTVSASDAATVADKILWEITRF FLLAIELSVIILGLAFGHLESKSSIKRVLAITTVLSLAYSVTQGTLEILYPDSHLSAEDF NIYGHGGRQFWLVSSCFFFLVYSLVVILPKTPLKERVSLPSRRSFYVYAGILATLNLLQG LGSALLCANIIVGLCCVDATTFLYFSFFAPLIYVAFLRGFFGSEPKILFSYKCQVDEAEE PDMHLPQPYAVARREGIESAGPACASAANYSSTQFDSAGVAYLDDIASMPCHTGSINSTD SERWKAINA
Source in vitro E.coli expression system
Gene Names Tpra1
Protein Names Recommended name: Transmembrane protein adipocyte-associated 1 Alternative name(s): Integral membrane protein GPR175 TPRA40 Transmembrane domain protein of 40 kDa regulated in adipocytes
Expression Region 1-369
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families UPF0359 family
Tissue Specificity Ubiquitous, with higher levels in heart, brain, lung, liver and kidney.
Database Links

KEGG: mmu:24100

STRING: 10090.ENSMUSP00000063042

UniGene: Mm.284480

Related Products

Tpra1 Proteins

Tpra1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.