Recombinant Mouse UPF0466 protein C22orf32 homolog, mitochondrial

Code CSB-CF866736MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9DB10
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence VIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD
Source in vitro E.coli expression system
Gene Names Smdt1
Protein Names Recommended name: UPF0466 protein C22orf32 homolog, mitochondrial
Expression Region 48-107
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Essential regulatory subunit of the mitochondrial calcium uniporter complex (uniplex), a complex that mediates calcium uptake into mitochondria
Subcellular Location Mitochondrion inner membrane, Single-pass membrane protein
Protein Families SMDT1/EMRE family
Tissue Specificity Widely expressed.
Database Links

KEGG: mmu:69029

STRING: 10090.ENSMUSP00000023086

UniGene: Mm.260042

Related Products

Smdt1 Proteins

Smdt1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.