Recombinant Mouse Visual pigment-like receptor peropsin(Rrh)

Code CSB-CF020517MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O35214
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPT NAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVA MDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR NNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTK MSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKK FRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI
Source in vitro E.coli expression system
Gene Names Rrh
Protein Names Recommended name: Visual pigment-like receptor peropsin
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in rpe physiology either by detecting light directly or by monitoring the concentration of retinoids or other photoreceptor-derived compounds.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Found only in the eye, where it is localized to the retinal pigment epithelium (RPE). In the RPE, it is localized to the microvilli that surround the photoreceptor outer segments.
Database Links

KEGG: mmu:20132

STRING: 10090.ENSMUSP00000029648

UniGene: Mm.278758

Related Products

Rrh Proteins

Rrh Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.