Recombinant Mouse XK-related protein 5(Xkr5)

Code CSB-CF705074MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5GH66
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MHAGLLGLSALLQAAEQSARLCSIVFYFATGRLLWGWLALSVLLPGFLVQALSFLWFRAD GHQGQWWLAVLHLLQLGVWKRHWDSVATALWKGKEAPSWGQLHLQEADLSALRLLEALLQ TGPHLLLQAYVFLASDFTDIVPGISALLSWSSLSWALVSYNRFLGIMKPGHHTMLWAALL CQQLWRMGMLGARVLSLVLFCRVYRVWVLVVGGAHWLVMTFWLVAQQSDIVESTCHWRLF NLLVGAVFILCYINFWDSPSRSRVASFYLVMLLENSILLLLATDFLQGVPGTSLWTVVGV LSGFLIGCASLVIYYSLLHPKSSDIQQSFMRKCCGPIEDNKPESEPPPRAVDPTGEMPDS SSWCQEESYELTSLDKAPSPEQNTAEVGLGEQRSGESSFFSHHHWLLLKLALKTGSVSRI NAALGGDSPGCSCPPLLGSSQHCDLQRKPLFSHQDLPSSPCDPLTLEKGSEYVGAPKAEM ESLETSSYLSFASELEDNATTQKPPATQEDSPKLAGSKADLAAQGKETEGPLQGKEGQES TTLYFSAAMDRTTSHQRGSPVVLRISHSETLVESRPGQPALPQAVTKPFPVTVANISPIP GRNFRPSAELPGRAPDSSECEEWKDAARDPSMQSSLPKMRLKAAEEPCFTSTPKSESIQR DYSCRDRVRQEMSFFI
Source in vitro E.coli expression system
Gene Names Xkr5
Protein Names Recommended name: XK-related protein 5
Expression Region 1-676
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families XK family
Database Links

KEGG: mmu:319581

STRING: 10090.ENSMUSP00000093089

UniGene: Mm.111354

Related Products

Xkr5 Proteins

Xkr5 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.