Recombinant Mouse XK-related protein 6(Xkr6)

Code CSB-CF026202MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. E9Q6C8
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MAAKSDGGGVGVGFAQLHNLDEAVGSGEEDGEPGGGGCGGGDGSEPGESSSLHICHCCNT SSCYWGCRSACLRSLLGKKPRRSAAAADGGDQPLQPPGAAGRHPPTPSAGRPQPASPQVE RPWLDCLWIVLALLVFFGDVGTDLWLALDYYRKGDYGCFGLTLFFVLVPSLLVQSLSFRW FVQDYTGGGLGAVEGLSSRGPPMMGAGYGHGAARGGPGAGGSATPGAQRLCRLSVWIWQS VIHLLQMGQVWRYIRTMYLGIQSQRQKEHQRRFYWAMMYEYADVNMLRLLETFLESAPQL VLQLCIMIQKNSAETLPCVSSVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHLFW RLFTISSRVISFALFASIFQLYFGIFVVVHWCAMAFWIIHGGTDFCMSKWEEILFNMVVG IVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLWYFYRNPESTDSYAVPALCCVFVS FVAGITLMLLYYGVLHPMGPRAKVFASSCCAELLWGIPLPPDVEPMAPQTPGYRGTQVTP TRAVTEQQEDLTADTCLPVFQVRPMGPSTPSGRPYHPEGPLIKIDMPRKRYPAWDAHFVD RRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
Source in vitro E.coli expression system
Gene Names Xkr6
Protein Names Recommended name: XK-related protein 6
Expression Region 1-638
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families XK family
Database Links

KEGG: mmu:219149

STRING: 10090.ENSMUSP00000113708

UniGene: Mm.32071

Related Products

Xkr6 Proteins

Xkr6 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.