Recombinant Mouse Xyloside xylosyltransferase 1(Xxylt1)

Code CSB-CF664930MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3U4G3
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MGLLRGGAACARAMARLGALRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARA GAAAPTPPAPELARGSAAPASGAKAKSLEGGVVVPVDYHLLMMFTKAEHNAPLQAKARVA LSSLLRLAKFEAHEVLNLHFVSEEASREVAKALLRELLPPAAGFKCKVIFHDVAVLTDKL FPVVEAMQKYFSAGSGTYYSDSIFFLSVAMHQIMPKEIPRIIQLDLDLKYKTNIRELFEE FDNFLPGAVIGIAREMQPVYRHTFWQFRHENPKTRVGDPPPEGLPGFNSGVMLLNLEAMR QSPLYSHLLEPSWVQQLADKYHFRGHLGDQDFFTMIGMEHPELFHVLDCTWNRQLCTWWR DHGYSDVFQAYFRCEGHVKIYHGNCNTPIPED
Source in vitro E.coli expression system
Gene Names Xxylt1
Protein Names Recommended name: Xyloside xylosyltransferase 1 EC= 2.4.2.n3 Alternative name(s): UDP-xylose:alpha-xyloside alpha-1,3-xylosyltransferase
Expression Region 1-392
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Alpha-1,3-xylosyltransferase, which elongates the O-linked xylose-glucose disaccharide attached to EGF-like repeats in the extracellular domain of target proteins by catalyzing the addition of the second xylose. Known targets include Notch proteins and coagulation factors, such as F9.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 8 family
Database Links

KEGG: mmu:268880

UniGene: Mm.286693

Related Products

Xxylt1 Proteins

Xxylt1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.