Recombinant Mouse Zinc transporter ZIP4 (Slc39a4)

Code CSB-CF748511MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Slc39a4
Uniprot No.
Alternative Names
Slc39a4; Zip4; Zinc transporter ZIP4; Activated in W/Wv mouse stomach 2; mAWMS2; Solute carrier family 39 member 4; Zrt- and Irt-like protein 4; ZIP-4
Species
Mus musculus (Mouse)
Expression Region
23-660
Target Protein Sequence
RPRNLLSLLALGQGALDRLELDGLLNTLVARVHCTDGPCEKCLSVENVLALGKPDKPQPA PESVLESRHIIYLSAAAALYLNNPEKTCKDIQAGLLASHVDDYLATLESPEAMTLGLSQL LQKIEAHAASQPTGEKTCVDLPQLLEEAEAAGVSKSAGLVLTALLDHVINGSCFQGLPSP QYFVDFVFRLHSSDPPNITLHELENLMHHLGVGGEDHSDHDDHGDHADHSHPDRKASHQD SELHTPHNSNSSVWDTLCLSAKDIMAVYGLSEEAGVSPQAWAQLTPALVQQQLSGACSPY PTIRIQDQLSQTERYLYGSLATLLICLCAVFGLLLLTCAKCSTATHYIMQTFLSLAVGAL TGDALLHLIPKVLGLHTHGGEGHTHEEEVGVGGQATWRLLAVLGGFYIFFLFESFFNLLL PRDQDSEKDGPCSHGGHSHGISLQLAPSNLRQSKQTHESSRSDLVAEETPELLNPETRRL RAELRLLPYLITLGDAVHNFADGLAVGAAFSSSWKTGLATSLAVFCHELPHELGDFAALL HAGLSVKRALLLNLASALTAFAGLYVALAVGVGEEGEAWILAVATGLFLYVALCDMLPAM MNVRDQRPWLLFLLHNVGLLGGWTVLLLLSLYEDNITF
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in cellular zinc homeostasis as a zinc transporter. Regulated in response to zinc availability.
Gene References into Functions
  1. While Zip4 was not found to be essential for proper glucose homeostasis and insulin secretion in vivo in mice, this study found that Zip4 mediates increases in cytoplasmic and granular zinc pools and stimulates glucose dependent insulin secretion in-vitro PMID: 25806541
  2. These studies strongly suggest that wasting and lethality in acrodermatitis enteropathica patients reflects the loss-of-function of the intestine zinc transporter ZIP4, which leads to abnormal Paneth cell gene expression PMID: 22737083
  3. Cell migration assays revealed that RNAi knockdown of Zip4 in Hepa cells depressed in vitro migration whereas forced over-expression in Hepa cells and MCF-7 cells enhanced in vitro migration PMID: 20957146
  4. ZIP4 physically interacts with tPA, correlating with an increased intracellular zinc influx and lysosomal sequestration after excitotoxin stimulation. Changes in prosurvival signals support the idea that this sequestration results in neuroprotection. PMID: 20463217
  5. results provide compelling evidence that ZIP4 is a zinc transporter that plays an important role in zinc homeostasis, a process that is defective in acrodermatitis enteropathica in humans PMID: 12801924
  6. Zinc deficiency increased mZIP4 protein levels at the plasma membrane, and this was associated with increased zinc uptake. PMID: 14612438
  7. ZIP4 and ZIP5 have roles in the adaptive response to dietary zinc in mice PMID: 15358787
  8. that heterozygous mutations in the acrodermatitis gene Zip4 (Slc39a4) may be associated with a wider range of developmental defects than was previously appreciated, particularly when dietary zinc is limiting. PMID: 17483098
  9. ZIP4 is induced by zinc deficiency in cultured mouse Hepa cells and is rapidly degraded in response to added zinc PMID: 18020946
  10. The processing of ZIP4 may represent a significant regulatory mechanism controlling its function. PMID: 18936158
  11. KLF4 is induced during zinc restriction and is a transcription factor involved in adaptive regulation of the zinc transporter ZIP4 PMID: 19147802

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Note=Colocalized with TFRC in the recycling endosomes. Cycles between endosomal compartments and the plasma membrane in response to zinc availability.
Protein Families
ZIP transporter (TC 2.A.5) family
Tissue Specificity
Highly expressed in the small intestine and embryonic visceral yolk sac. Weakly expressed in the stomach and liver. Found to the apical surface of enterocytes and visceral endoderm cells during zinc deficiency.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X