Recombinant Murid herpesvirus 1 G-protein coupled receptor homolog M33

Code CSB-CF767752MJT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q83207
Storage Buffer Tris-based buffer,50% glycerol
Species Murid herpesvirus 1 (strain Smith) (MuHV-1) (Mouse cytomegalovirus)
Sequence MDVLLGRDETMDESDYLHVNNTCAPSLGLSIARDAETAINTVIILIGGPMNFVVLTTQLL SNRIYRSSAPTLYMTNLYFANLLTVTMLPFLILSNRGQISSSPEGCKLVAVTYYASCTAG FSTLALISVNRYRVIHQSTNKNAAGSKKKTYGVLALVWLTSLMCASPAPTYVTVLAHDGD TPDSVHETCIIFFNYDQVKTVLATFKILICIVWGVMPVVMMTWFYLFFYKRLKLTSYRRR SHTLAFVSTLILSFLVLQTPFVGIMIFDSYAVIEWDVTCESINSRDAVAMLARVVPNFHC MLNPVLYAFLGRDFNKRFMQCITGKLFSRRRMLQERAGVRSPSTPHRAARQLAKIGTLTR SCSRSELQRSASAPPPQ
Source in vitro E.coli expression system
Protein Names Recommended name: G-protein coupled receptor homolog M33
Expression Region 1-377
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in vivo, in particular in the dissemination to or replication in the salivary gland.
Subcellular Location Host cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family

Related Products

Proteins

Proteins for Murid herpesvirus 1 (strain Smith) (MuHV-1) (Mouse cytomegalovirus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.