Recombinant Murine adenovirus A serotype 1 Early E3 17.7 kDa glycoprotein

Code CSB-CF321718MUS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P19720
Storage Buffer Tris-based buffer,50% glycerol
Species Murine adenovirus A serotype 1 (MAdV-1) (Murine adenovirus 1)
Sequence MGKLTVCTSKPYLNFSRAIRTYLCGSKCDNAIYFTPQKIVIELVQEKKTTQLLLLLAASI ALYLLSPQLGARMLFELVQARTTSVSNSSVAAALFACAGEEIINPAIFLFLHVLTLVIVL AMAAEVIYNRCRRTTRPTAPPPPVNNADFNLADALDETYNK
Source in vitro E.coli expression system
Protein Names Recommended name: Early E3 17.7 kDa glycoprotein
Expression Region 1-161
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Host membrane, Single-pass membrane protein

Related Products

Proteins

Proteins for Murine adenovirus A serotype 1 (MAdV-1) (Murine adenovirus 1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.