Recombinant Mycoplasma pneumoniae Oligopeptide transport system permease protein oppC(oppC)

Code CSB-CF304285MLW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P75553
Storage Buffer Tris-based buffer,50% glycerol
Species Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Sequence MDKHQKFDQSLFQRVDINVLKRSDQLIGKPTTNFVEIMKRLFQNKWAILFFLLIVLIILL AIIVPLASPYSAVTPVSNNALAQNLPPRYLWNGAGDIQVEKITARSIAEVAQSSGVLVGK LPEASSNPLATNVKYNIAPYQLAELKNYYPLLGTNGLGVDIWTLLWASMAKSLWIAIVVA LVSMVFGTIYGAIAGSFVGRAADNIMSRIIEIIDLVPSILWIIVLGATFRFGGVKQFDDS VVIFTLIFVFWTWPAATTRIYILKNKDTEYIQAARTLGAKQIRIIFVHMLPVVTGRLAVV FVSLIPAVIGYEASLVFLGLKPATEVGLGALLNQVTSSGNIALITSSIVSFAILTVSTRV FANALNDAIDPRVIRR
Source in vitro E.coli expression system
Gene Names oppC
Protein Names Recommended name: Oligopeptide transport system permease protein oppC
Expression Region 1-376
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the binding-protein-dependent transport system for oligopeptides; probably responsible for the translocation of the substrate across the membrane.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Binding-protein-dependent transport system permease family, OppBC subfamily
Database Links

KEGG: mpn:MPN216

Related Products

oppC Proteins

oppC Proteins for Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.