Recombinant Mycoplasma pneumoniae Uncharacterized protein MG256 homolog (MPN_359)

Code CSB-CF304267MLW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P75421
Storage Buffer Tris-based buffer,50% glycerol
Species Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Sequence MNYSYSFKEYIERFAKKVNSIDSEYFEFSSYIERMRTVFGLLIALICFSNVLCFLFIATW FSTKGFGQHYRALIFTLFIPFVTSLLANIIFINLNRAFREYFKISSKSRSFLVICAFSSL PIVNIWLMLWWVAMIKRFTSNYAFAIFDKYNGLTSGVFIFDFADNVNFEGKLVSFDNTKD TNRDFVHFYSEAKLKRDKITLQTNPIPHERMYVNRMYYQQKLSMGANQNSPSTAFANLKR YVEHKQQKIIKIKQFILT
Source in vitro E.coli expression system
Gene Names MPN_359
Protein Names Recommended name: Uncharacterized protein MG256 homolog
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: mpn:MPN359

Related Products

MPN_359 Proteins

MPN_359 Proteins for Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.