Recombinant Neisseria meningitidis serogroup B Biopolymer transport protein exbB(exbB)

Code CSB-CF352556NGG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P64100
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Neisseria meningitidis serogroup B (strain MC58)
Sequence MNLKLVFESGDPVLIGVFVLMLLMSIVTWCLVVLRCIKLYRARKGNAAVKRHMRDTLSLN DAVEKVRAVDAPLSKLAQEALQSYRNYRRNEASELAQALPLNEYLVIQIRNSMAQIMRRF DYGMTALASIGATAPFIGLFGTVWGIYHALINIGQSGQMSIAAVAGPIGEALVATAAGLF VAIPAVLAYNFLNRGTKILTQDLDAMAHDLHVRLLNQKDS
Source in vitro E.coli expression system
Gene Names exbB
Protein Names Recommended name: Biopolymer transport protein exbB
Expression Region 1-220
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the TonB-dependent energy-dependent transport of various receptor-bound substrates. Protects ExbD from proteolytic degradation and functionally stabilizes TonB (By similarity).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ExbB/TolQ family
Database Links

KEGG: nme:NMB1729

STRING: 122586.NMB1729

Related Products

exbB Proteins

exbB Proteins for Neisseria meningitidis serogroup B (strain MC58)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.