Recombinant Neosartorya fumigata GPI mannosyltransferase 3(gpi10)

Code CSB-CF684210NGS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q4WPG0
Storage Buffer Tris-based buffer,50% glycerol
Species Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Sequence MSSSRRRKSFTSSSSSSSPSFHSPPPTSRLRPRSPPSSNTKTSPTSTTPLATNILLSLIA FRLVNAFTVRTFFQPDEFFQSLEPAWQIAFGENQGAWITWEWRHQLRSSIHPLLFAAVYS AADVVAQLLRLSLASRADLLVAAPKTAQAVIAGLGDFYTWKLARYVYGARSYEAWATLAL TVVSPWQWFCSTRTLSNCLETTITIVALYLWPWSWSFETPVRKKATRAASRERAQRGPEG SDSLQRLRQCLSLAAVACILRPTNILIWMGLASVAWFRTSWDRRAILVREVLLCGCAVLG LSCVVDRLFYGSWTFPPLRFLYFNIAQSLAVFYGRNDWHYYVSQGFPLLLTTALPFALVG LYRALAQVRTFGLGHLQSLVQAQLALICVIMPFVLSLVSHKEVRFIYPLLPSLHILSAPP LVDYFLPAVIRSSRSYTPRRLTLIFLLLVNIVIALYTTIYHASGPSNILSYLRQQHELHA PAAQTPSNLRPSVKDPSPHGITAGFLMPCHSTPWRSHLIYPTIHAWALTCEPPVDQTAAQ KATYIDEADQFYANPARFLREHMAGGLRHISRKPSYLSAQPRPQHPSTTSTNDASHEWPD YLIFFAQLEPTLQSLLRASSYAECYRTFNTAWHDDWRRKGDIVAWCLDPAEQQAWRSATR QRDLENRERQFDRIIESFRKEASGKRDGKLSPFRRWFSSSSSVAPSSSLSLSWPTSWRWP WGQRKRTAWLGVQIPQWTRTRPSWTAWGGDWFGGWRQKKKTKKLLERDLWS
Source in vitro E.coli expression system
Gene Names gpi10
Protein Names Recommended name: GPI mannosyltransferase 3 EC= 2.4.1.- Alternative name(s): GPI mannosyltransferase III Short name= GPI-MT-III Glycosylphosphatidylinositol-anchor biosynthesis protein 10
Expression Region 1-771
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers the third mannose to Man2-GlcN-acyl-PI during GPI precursor assembly (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Glycosyltransferase 22 family, PIGB subfamily
Database Links

KEGG: afm:AFUA_4G09130

STRING: 5085.CADAFUBP00006447

Related Products

gpi10 Proteins

gpi10 Proteins for Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.