Recombinant Neurospora crassa Palmitoyltransferase AKR1(akr-1)

Code CSB-CF742419NHA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7S3M5
Storage Buffer Tris-based buffer,50% glycerol
Species Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Sequence MVHHDGADAHAGHAAPAQPPMKSDTATPKLNSEVELGSLPSEAHNDIMQMARVGDITGME KLFAAGEYDATYSDDEGITPLHWAAINNQYAMCKFLIDKGAEINKKGGESVATPLQWAAQ RCHYYTVHLLLQHGADPLITDSQGYNTLHISTFNGNVLLIVLLLHQGIPVDVEDAYGHTA LMWSAYKGFPACVDVFLRWGASVHAKDEQGFTALHWALVKGSPGCIQKLIEYGADRFAKT ANGKTPAITAQELNTVAAWQKALDECGYDEHGNAIVPSWPGASYLLQDRRSFMTKFTFLW PFVMVWATMVVMAGMPVFVGIPLGVLAGYAVQWVAQQVIAYAPPDMRQLQKTPWMAGIFA GSLFLCIMNWLLHIFGSTMFGQDSAVIPNLLFAFFISMTIWFYIRCMVDDPGFVPKMGGV AEQKAVIDELISLWKFDESNFCVTCMIRTPLRSKHCRRCQRCVAKHDHHCPWVYNCIGVN NHRHFFFYLINLTLSVVTYDWLTYRYLSTLSETASDECNILAPSLCRIVNADTYSLLTAI WASLQLTWVSMLLFVQFVQVSSAMTTYENMHGIDNYSATSLNSSFTSTGAPLNPPSLPAP GPSPAAGGARHGGRHAHGHNHKQGFIKQWSRLLGVDAFIETAAGRGATTGKGSKRNKRGN PYSRGCVTNCKDFWCDPSPMFGKHENGAAVLGGVPVNYTDMYESPGVMTSGGGGRRRGGG YESVAGEEV
Source in vitro E.coli expression system
Gene Names ptr-1
Protein Names Recommended name: Palmitoyltransferase AKR1 EC= 2.3.1.- Alternative name(s): Ankyrin repeat-containing protein AKR1
Expression Region 1-729
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Palmitoyltransferase specific for casein kinase 1.
Subcellular Location Early endosome membrane, Multi-pass membrane protein, Golgi apparatus membrane, Multi-pass membrane protein
Protein Families DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Database Links

KEGG: ncr:NCU08218

Related Products

ptr-1 Proteins

ptr-1 Proteins for Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.