Recombinant Neurospora crassa Peptidyl-prolyl cis-trans isomerase B(cpr-2)

Code CSB-CF745786NHA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7S7Z6
Storage Buffer Tris-based buffer,50% glycerol
Species Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Sequence AKGPKITHKVYFDIEQGDKPLGRIVMGLYGKTVPKTAENFRALATGEKGFGYEGSTFHRV IKQFMIQGGDFTKGDGTGGKSIYGDKFPDENFKLKHSKKGLLSMANAGKDTNGSQFFITT VITSWLDGKHVVFGEVLEGYDVVEKIENTKTGPRDAPAEPIKIAKSGELEVPPEGLEGQS EWASPAYANEDEKPAAPVPVTDAKPPAHDSIPAATADDDDTGAPLFAKVLFFGVLVLGLV LYIRLRRAPKGTYGKGME
Source in vitro E.coli expression system
Gene Names cpr2
Protein Names Recommended name: Peptidyl-prolyl cis-trans isomerase B Short name= PPIase B EC= 5.2.1.8 Alternative name(s): Rotamase B
Expression Region 28-285
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).
Subcellular Location Isoform Long: Membrane, Single-pass membrane protein, SUBCELLULAR LOCATION: Isoform Short: Endoplasmic reticulum lumen
Protein Families Cyclophilin-type PPIase family, PPIase B subfamily
Database Links

KEGG: ncr:NCU01200

Related Products

cpr2 Proteins

cpr2 Proteins for Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.