Recombinant Neurospora crassa pH-response regulator protein palH/rim-21(rim-21)

Code CSB-CF766412NHA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7RY98
Storage Buffer Tris-based buffer,50% glycerol
Species Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Sequence MEPRQLFSDPTADPISTAGAASNALSCASFNLPEGGILQLPNGEIITLSAPAAFKPPSCN LALRSVPNIIASGGVVGGTASGTMGLKADDDSHFSDWRDPFYASTFPQCYALAATTIIAY TLVIMLFITPRSFLDGGVVVLGRKGFTNGGGGTSIGGRPWLQKVAALSVAISLTIANAAT FRAAEQQYSWGVQNAKQLQEDVLGGAELKIIRIISDTFLWLAQAQTLIRLFPRQREKVII KWTAFALITLDVIFQSLNSFKYGGSDLTRPKFTEAVPALSYLFALALGVLYAAWVLYYSI MKKRYAFYHPLMKNMILVAVLSVVSILVPVVFFILDISKPDFAGWGDYVRWVGAAAASVI VWEWVERIEALEREEKKDGILGREVFDGDEMLEASQSEHAWPKMKRKGSGGSDSQDTESG GGGKDGGPSLSRFGAWSKISTLTSKHRTEPSSRNEPNEGSSPVAETTNDDERPRFLSPPL WPARPTPAATPVSRTDTTSAASTMYAVRYHTMTELTSYGTPPPTRNMGRLSGSESRGSSR HRDYGSASPGSAPAQDARSTQNSHVGAKASSAGSRWHALTPTVSSRDFVTRSEPRSSKMQ RDENSRWDLRARVEEFAATQAENLREKFRPTLDTNNLPVTVIPAPPRRGAAIAQLCEEEE LNHSSREGTVREESRNSNASGTVIAVGGAQTPIQTSFSPPPRAANSSMSTAQMPRPQLSP IVTQGSFTNNRYNHLPVTVIPAPPRQDPARAPSQPQSPSLVALGKQPARSDSSTTPSP
Source in vitro E.coli expression system
Gene Names prr-4
Protein Names Recommended name: pH-response regulator protein palH/rim-21
Expression Region 1-778
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the proteolytic cleavage of the transcription factor pacc-1 in response to alkaline ambient pH.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PalH/RIM21 family
Database Links

KEGG: ncr:NCU00007

Related Products

prr-4 Proteins

prr-4 Proteins for Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.