Recombinant Nocardioides sp. Protoheme IX farnesyltransferase(ctaB)

Code CSB-CF005824NFC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A1SJR1
Storage Buffer Tris-based buffer,50% glycerol
Species Nocardioides sp. (strain ATCC BAA-499 / JS614)
Sequence MTYVGQSASAAQQSVAERASVKDVLAAYVGLTKPRVIELLLLTTVPVMFFADRGIPELWL VVATVVGGAFSAGSASVFNCVYDRDIDEQMRRTRRRALPRHIVSPAAALVFGFVLGILST VILYVWVNPLSAALSVAANAFYVLVYTMLLKRRTTQNIVWGGLAGCFPALIGWTAVTGSL SWVPVVLFAVVFFWTPPHTWALALRYREDYANVDVPMLPVVAPAREVGRQVVIYSWVMVA TSLLLWPVAGTGIFYPIAAGVLGAVFLLEAHRMWARSRDTESLSVIQPMRLFHSSNLYLS LLFVAVALDPLLAG
Source in vitro E.coli expression system
Gene Names ctaB
Protein Names Recommended name: Protoheme IX farnesyltransferase EC= 2.5.1.- Alternative name(s): Heme B farnesyltransferase Heme O synthase
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Database Links

KEGG: nca:Noca_2542

STRING: 196162.Noca_2542

Related Products

ctaB Proteins

ctaB Proteins for Nocardioides sp. (strain ATCC BAA-499 / JS614)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.