Recombinant Nocardioides sp. Protoheme IX farnesyltransferase(ctaB)

Code CSB-CF005824NFC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A1SJR1
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Nocardioides sp. (strain ATCC BAA-499 / JS614)
Sequence MTYVGQSASAAQQSVAERASVKDVLAAYVGLTKPRVIELLLLTTVPVMFFADRGIPELWL VVATVVGGAFSAGSASVFNCVYDRDIDEQMRRTRRRALPRHIVSPAAALVFGFVLGILST VILYVWVNPLSAALSVAANAFYVLVYTMLLKRRTTQNIVWGGLAGCFPALIGWTAVTGSL SWVPVVLFAVVFFWTPPHTWALALRYREDYANVDVPMLPVVAPAREVGRQVVIYSWVMVA TSLLLWPVAGTGIFYPIAAGVLGAVFLLEAHRMWARSRDTESLSVIQPMRLFHSSNLYLS LLFVAVALDPLLAG
Source in vitro E.coli expression system
Gene Names ctaB
Protein Names Recommended name: Protoheme IX farnesyltransferase EC= 2.5.1.- Alternative name(s): Heme B farnesyltransferase Heme O synthase
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Database Links

KEGG: nca:Noca_2542

STRING: 196162.Noca_2542

Related Products

ctaB Proteins

ctaB Proteins for Nocardioides sp. (strain ATCC BAA-499 / JS614)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.