Recombinant Norwalk virus Genome polyprotein (ORF1)

Code CSB-CF802684NBAY
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ORF1
Uniprot No.
Alternative Names
ORF1; Genome polyprotein
Species
Norwalk virus (strain GI/Human/United States/Norwalk/1968) (Hu/NV/NV/1968/US)
Expression Region
1282-1789
Target Protein Sequence
GGDKGHYAGHEIVRYGSGPALSTKTKFWRSSPEPLPPGVYEPAYLGGKDPRVQNGPSLQQ VLRDQLKPFADPRGRMPEPGLLEAAVETVTSMLEQTMDTPSPWSYADACQSLDKTTSSGY PHHKRKNDDWNGTTFVGELGEQAAHANNMYENAKHMKPIYTAALKDELVKPEKIYQKVKK RLLWGADLGTVVRAARAFGPFCDAIKSHVIKLPIKVGMNTIEDGPLIYAEHAKYKNHFDA DYTAWDSTQNRQIMTESFSIMSRLTASPELAEVVAQDLLAPSEMDVGDYVIRVKEGLPSG FPCTSQVNSINHWIITLCALSEATGLSPDVVQSMSYFSFYGDDEIVSTDIDFDPARLTQI LKEYGLKPTRPDKTEGPIQVRKNVDGLVFLRRTISRDAAGFQGRLDRASIERQIFWTRGP NHSDPSETLVPHTQRKIQLISLLGEASLHGEKFYRKISSKVIHEIKTGGLEMYVPGWQAM FRWMRFHDLGLWTGDRDLLPEFVNDDGV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protein p48 may play a role in viral replication by interacting with host VAPA, a vesicle-associated membrane protein that plays a role in SNARE-mediated vesicle fusion. This interaction may target replication complex to intracellular membranes.; NTPase presumably plays a role in replication. Despite having similarities with helicases, does not seem to display any helicase activity.; Protein P22 may play a role in targeting replication complex to intracellular membranes.; Viral genome-linked protein is covalently linked to the 5'-end of the positive-strand, negative-strand genomic RNAs and subgenomic RNA. Acts as a genome-linked replication primer. May recruit ribosome to viral RNA thereby promoting viral proteins translation.; 3C-like protease processes the polyprotein: 3CLpro-RdRp is first released by autocleavage, then all other proteins are cleaved. May cleave host polyadenylate-binding protein thereby inhibiting cellular translation.; RNA-directed RNA polymerase replicates genomic and antigenomic RNA by recognizing replications specific signals. Transcribes also a subgenomic mRNA by initiating RNA synthesis internally on antigenomic RNA. This sgRNA codes for structural proteins. Catalyzes the covalent attachment VPg with viral RNAs.
Gene References into Functions
  1. A computational study of the norovirus RNA-dependent RNA polymerase revealed its metal-binding preferences. PMID: 28383118
  2. Protease processing at ORF1 cleavage sites is primarily regulated by the P4-P2' sequences. PMID: 24991013
  3. In the X-ray structure of a Norwalk virus protease construct, authors observed that the C-terminal tail, representing the native substrate positions P5 to P1, is inserted into the active site cleft of the neighboring protease molecule. PMID: 23365454
  4. The protease of Norwalk virus and MD145 exhibited enzymatic activity with similar cleavage efficiency on each substrate. PMID: 22200497
Subcellular Location
[Protein p48]: Host membrane; Single-pass membrane protein.; [NTPase]: Host membrane; Single-pass membrane protein.; [Protein p22]: Host membrane; Single-pass membrane protein.
Database Links

KEGG: vg:1491970

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X